NDUB4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDUB4_MOUSE
• UniProt AC: Q9CQC7
• Protein Name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
• Gene Name: Ndufb4
• Organism: Mus musculus (Mouse).
• Sequence Length: 129
• Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein ; Matrix side .
• Protein Description: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone..
• Protein Sequence: MSGSKYKPAPLATLPSTLDPAEYDVSPETRRAQVERLSIRARLKREYLLQYNDPKRVSHIEDPALIRWTYARSANIYPNFRPTPKNSLLGAVAGFGPLIFWYYVFKTDRDRKERLIQEGKLDRKFNISY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGSKYKPA ------CCCCCCCCC	52.34	-
23	Phosphorylation	STLDPAEYDVSPETR CCCCHHHCCCCHHHH	24.61	23140645
26	Phosphorylation	DPAEYDVSPETRRAQ CHHHCCCCHHHHHHH	17.70	21082442
29	Phosphorylation	EYDVSPETRRAQVER HCCCCHHHHHHHHHH	28.92	22817900
38	Phosphorylation	RAQVERLSIRARLKR HHHHHHHHHHHHHHH	19.09	22817900
51	Phosphorylation	KREYLLQYNDPKRVS HHHHHHHCCCCCCCC	22.85	25195567
55	Acetylation	LLQYNDPKRVSHIED HHHCCCCCCCCCCCC	69.19	23864654
55	Succinylation	LLQYNDPKRVSHIED HHHCCCCCCCCCCCC	69.19	26388266
58	Phosphorylation	YNDPKRVSHIEDPAL CCCCCCCCCCCCHHH	23.84	27742792
120	Acetylation	ERLIQEGKLDRKFNI HHHHHCCCCCCCCCC	46.60	24062335
120	Malonylation	ERLIQEGKLDRKFNI HHHHHCCCCCCCCCC	46.60	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDUB4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDUB4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDUB4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NDUB4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.