dbPTM

NDUAC_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NDUAC_ARATH
UniProt AC	Q9M9M9
Protein Name	Probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Gene Name	At3g03100
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	159
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side.
Protein Description	Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity)..
Protein Sequence	MALTVAKSALEAIREKGLGGFMRMIREEGFMRCLPDGNLLQTKIHNIGATLVGVDKFGNKYYQKLGDTQYGRHRWVEYASKDRYNASQVPAEWHGWLHFITDHTGDELLSLKPKRYGLEHKENFSGEGDAYIYHSKGHTLNPGQKNWTRYQSWVPTKTQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of NDUAC_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NDUAC_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NDUAC_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NDUAC_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NDUAC_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NDUAC_ARATH

Related Literatures of Post-Translational Modification