UniProt ID | NDUA8_MOUSE | |
---|---|---|
UniProt AC | Q9DCJ5 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 | |
Gene Name | Ndufa8 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 172 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . Mitochondrion . |
|
Protein Description | Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.. | |
Protein Sequence | MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Succinylation | LPTLEELKVEEVKVS CCCHHHEEEEEEECC | 51.37 | 23954790 | |
38 | Acetylation | HYGAQCDKTNKEFML HCCCCCCCCCCEEEE | 62.72 | 23864654 | |
61 | Acetylation | RRCLKEGKLVNGCAL HHHHHHCCEECCHHH | 50.80 | 23201123 | |
66 | S-nitrosylation | EGKLVNGCALNFFRQ HCCEECCHHHHHHHH | 3.08 | 22588120 | |
66 | S-palmitoylation | EGKLVNGCALNFFRQ HCCEECCHHHHHHHH | 3.08 | 28526873 | |
106 | Ubiquitination | HCRQQQAKFDQCVLD HHHHHHHHHHHHHHH | 45.17 | - | |
106 | Acetylation | HCRQQQAKFDQCVLD HHHHHHHHHHHHHHH | 45.17 | 23864654 | |
106 | Succinylation | HCRQQQAKFDQCVLD HHHHHHHHHHHHHHH | 45.17 | 26388266 | |
132 | Malonylation | LSKVTKVKTDRPLPE HCCCEECCCCCCCCC | 46.38 | 26320211 | |
132 | Succinylation | LSKVTKVKTDRPLPE HCCCEECCCCCCCCC | 46.38 | 23954790 | |
142 | Phosphorylation | RPLPENPYHSRARPE CCCCCCCCCCCCCCC | 24.82 | 22817900 | |
144 | Phosphorylation | LPENPYHSRARPEPN CCCCCCCCCCCCCCC | 23.07 | 26060331 | |
159 | Acetylation | PVIEGDLKPAKHGTR CCCCCCCCCCCCCCE | 47.90 | 24062335 | |
165 | Phosphorylation | LKPAKHGTRFFFWTV CCCCCCCCEEEEEEC | 24.83 | 24719451 | |
171 | Phosphorylation | GTRFFFWTV------ CCEEEEEEC------ | 15.92 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUA8_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUA8_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUA8_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDUA8_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...