UniProt ID | NDRG3_MOUSE | |
---|---|---|
UniProt AC | Q9QYF9 | |
Protein Name | Protein NDRG3 | |
Gene Name | Ndrg3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 375 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDELQDVQ -------CCCCCCCE | 9.01 | - | |
19 | Ubiquitination | IKPLLNDKNGTRNFQ CHHHHCCCCCCCCCC | 57.09 | - | |
51 | Ubiquitination | VTIRGLPKGNRPVIL EEECCCCCCCCCEEE | 74.08 | - | |
318 | Phosphorylation | QGMGYIPSASMTRLA HHCCCCCCHHHHHHH | 24.34 | 29899451 | |
320 | Phosphorylation | MGYIPSASMTRLARS CCCCCCHHHHHHHHC | 25.64 | 19060867 | |
322 | Phosphorylation | YIPSASMTRLARSRT CCCCHHHHHHHHCCC | 21.75 | 19060867 | |
327 | Phosphorylation | SMTRLARSRTHSTSS HHHHHHHCCCCCCCC | 35.60 | 27087446 | |
329 | Phosphorylation | TRLARSRTHSTSSSI HHHHHCCCCCCCCCC | 22.79 | 24925903 | |
331 | Phosphorylation | LARSRTHSTSSSIGS HHHCCCCCCCCCCCC | 29.39 | 24925903 | |
332 | Phosphorylation | ARSRTHSTSSSIGSG HHCCCCCCCCCCCCC | 25.64 | 24925903 | |
333 | Phosphorylation | RSRTHSTSSSIGSGE HCCCCCCCCCCCCCC | 25.71 | 25521595 | |
334 | Phosphorylation | SRTHSTSSSIGSGES CCCCCCCCCCCCCCC | 26.51 | 25521595 | |
335 | Phosphorylation | RTHSTSSSIGSGESP CCCCCCCCCCCCCCC | 30.64 | 25521595 | |
338 | Phosphorylation | STSSSIGSGESPFSR CCCCCCCCCCCCCCC | 37.40 | 24925903 | |
341 | Phosphorylation | SSIGSGESPFSRSVT CCCCCCCCCCCCCCC | 34.47 | 24925903 | |
344 | Phosphorylation | GSGESPFSRSVTSNQ CCCCCCCCCCCCCCC | 27.34 | 24925903 | |
346 | Phosphorylation | GESPFSRSVTSNQSD CCCCCCCCCCCCCCC | 28.66 | 25619855 | |
348 | Phosphorylation | SPFSRSVTSNQSDGT CCCCCCCCCCCCCCC | 24.17 | 25619855 | |
349 | Phosphorylation | PFSRSVTSNQSDGTQ CCCCCCCCCCCCCCH | 30.62 | 25619855 | |
352 | Phosphorylation | RSVTSNQSDGTQESC CCCCCCCCCCCHHCC | 42.11 | 25521595 | |
355 | Phosphorylation | TSNQSDGTQESCESP CCCCCCCCHHCCCCC | 33.87 | 25521595 | |
358 | Phosphorylation | QSDGTQESCESPDVL CCCCCHHCCCCCCCH | 17.23 | 25619855 | |
361 | Phosphorylation | GTQESCESPDVLDRH CCHHCCCCCCCHHHH | 30.63 | 25521595 | |
370 | Phosphorylation | DVLDRHQTMEVSC-- CCHHHHHHCEECC-- | 14.80 | 23527152 | |
374 | Phosphorylation | RHQTMEVSC------ HHHHCEECC------ | 10.78 | 25521595 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDRG3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDRG3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDRG3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NDRG3_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331, AND MASSSPECTROMETRY. | |
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-331; SER-334 ANDSER-335, AND MASS SPECTROMETRY. |