NDR1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDR1_ARATH
• UniProt AC: O48915
• Protein Name: Protein NDR1
• Gene Name: NDR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 219
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Description: Involved in disease resistance. Required for resistance conferred by multiple R genes recognizing different bacterial and oomycete pathogen isolates like avirulent P.syringae or H.parasitica (downy mildew). Required for the establishment of hypersensitive response (HR) and systemic acquired resistance (SAR) after infection with the bacterial pathogen P.syringae DC3000 carrying avrRpt2. Required for resistance to the soilborne fungus V.longisporum. Interaction with RIN4 is required for the activation of the R gene RPS2 and RPS2-mediated resistance..
• Protein Sequence: MNNQNEDTEGGRNCCTCCLSFIFTAGLTSLFLWLSLRADKPKCSIQNFFIPALGKDPNSRDNTTLNFMVRCDNPNKDKGIYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQTVLRAVLPNGSAVFRLDLKTQVRFKIVFWKTKRYGVEVGADVEVNGDGVKAQKKGIKMKKSDSSFPLRSSFPISVLMNLLVFFAIR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	N-linked_Glycosylation	KDPNSRDNTTLNFMV CCCCCCCCCEEEEEE	33.58	-
88	N-linked_Glycosylation	YYDDVHLNFSTINTT EEEEEEEECEEEECC	17.59	-
93	N-linked_Glycosylation	HLNFSTINTTKINSS EEECEEEECCEECCC	41.61	-
98	N-linked_Glycosylation	TINTTKINSSALVLV EEECCEECCCEEEEE	31.31	-
107	N-linked_Glycosylation	SALVLVGNYTVPKFY CEEEEEECCCCCHHH	23.09	-
132	N-linked_Glycosylation	GQVKPLNNQTVLRAV CCCCCCCCCEEEEEE	46.73	-
142	N-linked_Glycosylation	VLRAVLPNGSAVFRL EEEEECCCCCEEEEE	53.54	-
195	GPI-anchor	GIKMKKSDSSFPLRS CCCCCCCCCCCCCCC	58.12	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDR1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDR1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDR1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIN4_ARATH	RIN4	physical	17012600

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.