| UniProt ID | NDK3_ARATH | |
|---|---|---|
| UniProt AC | O49203 | |
| Protein Name | Nucleoside diphosphate kinase III, chloroplastic/mitochondrial | |
| Gene Name | NDPK3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 238 | |
| Subcellular Localization | Plastid, chloroplast thylakoid lumen. Mitochondrion intermembrane space. | |
| Protein Description | Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Shows the highest specificity towards GDP (By similarity).. | |
| Protein Sequence | MSSQICRSASKAAKSLLSSAKNARFFSEGRAIGAAAAVSASGKIPLYASNFARSSGSGVASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWEGDGVIRYGRKLIGATDPQKSEPGTIRGDLAVTVGRNIIHGSDGPETAKDEISLWFKPQELVSYTSNSEKWLYGDN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 96 | Acetylation | ERTFIAIKPDGVQRG EEEEEEECCCHHHHH | 28.21 | 24727099 | |
| 129 | Acetylation | IKVIVPSKDFAQKHY EEEEECCHHHHHHHH | 51.28 | 24727099 | |
| 140 | Acetylation | QKHYHDLKERPFFNG HHHHCHHHHCCCCCC | 58.70 | 24727099 | |
| 173 | Acetylation | GVIRYGRKLIGATDP CEEEECCEECCCCCC | 39.84 | 24727099 | |
| 182 | Acetylation | IGATDPQKSEPGTIR CCCCCCCCCCCCCCC | 63.27 | 24727099 | |
| 204 | Phosphorylation | GRNIIHGSDGPETAK CCCEECCCCCCCCCC | 25.82 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDK3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDK3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDK3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of NDK3_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
