| UniProt ID | NCTR1_HUMAN | |
|---|---|---|
| UniProt AC | O76036 | |
| Protein Name | Natural cytotoxicity triggering receptor 1 | |
| Gene Name | NCR1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 304 | |
| Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
| Protein Description | Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.. | |
| Protein Sequence | MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 84 | Phosphorylation | RINKVKFYIPDMNSR HHCEEEEEECCCCHH | 13.06 | 24719451 | |
| 90 | Phosphorylation | FYIPDMNSRMAGQYS EEECCCCHHHCCEEE | 19.45 | 24719451 | |
| 216 | N-linked_Glycosylation | LVTGDIENTSLAPED EEECCCCCCCCCCCC | 34.99 | UniProtKB CARBOHYD | |
| 292 | Phosphorylation | ERASRASTWEGRRRL HHHHHHHHHHHHHHC | 26.93 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NCTR1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NCTR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NCTR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CD3Z_HUMAN | CD247 | physical | 9625766 | |
| CD59_HUMAN | CD59 | physical | 14635045 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...