| UniProt ID | NCF2_MOUSE | |
|---|---|---|
| UniProt AC | O70145 | |
| Protein Name | Neutrophil cytosol factor 2 | |
| Gene Name | Ncf2 {ECO:0000312|MGI:MGI:97284} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 525 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).. | |
| Protein Sequence | MSLAEAIRLWNEGVLAADKKDWKGALEAFSEVQDPHSRICFNIGCVNTILENLQAAEQAFTKSINRDKHSAVAYFQRGMLYYRMEKYDLAIKDLKEALTQLRGNQLIDYKILGLQFKLFACEVLYNIALMHAKKEEWKKAEEQLALATNMKSEPRHSKIDKAMESIWKQKLFEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVHQDNFSGFAPLQPQSAEPPPRPKTPEIFRALEGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELRIHPQSQPQEDTSPESDIPPPPNSSPPGRLQLSPGHKQKEPKELKLSVPMPYMLKVHYKYTVVMETRLGLPYSQLRNMVSKKLALSPEHTKLSYRRRDSHELLLLSEESMKDAWGQVKNYCLTLWCEHTVGDQGLIDEPIQRENSDASKQTTEPQPKEGTQVVAIFSYEAAQPEDLEFVEGDVILVLSHVNEEWLEGECKGKVGIFPKAFVEGCAAKNLEGIPREV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 157 | Phosphorylation | MKSEPRHSKIDKAME CCCCCCHHHHHHHHH | 32.36 | 24719451 | |
| 203 | Phosphorylation | KDYLGKATVVASVVH HCCCCCCEEEEEEEC | 20.99 | 25367039 | |
| 207 | Phosphorylation | GKATVVASVVHQDNF CCCEEEEEEECCCCC | 17.05 | 25367039 | |
| 215 | Phosphorylation | VVHQDNFSGFAPLQP EECCCCCCCCCCCCC | 38.98 | 22345495 | |
| 224 | Phosphorylation | FAPLQPQSAEPPPRP CCCCCCCCCCCCCCC | 41.08 | 26745281 | |
| 233 | Phosphorylation | EPPPRPKTPEIFRAL CCCCCCCCHHHHHHH | 28.92 | 26824392 | |
| 291 | S-nitrosocysteine | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | - | |
| 291 | S-nitrosylation | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | 22178444 | |
| 291 | Glutathionylation | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | 24333276 | |
| 305 | Phosphorylation | ELRIHPQSQPQEDTS EEEECCCCCCCCCCC | 48.56 | 23459991 | |
| 311 | Phosphorylation | QSQPQEDTSPESDIP CCCCCCCCCCCCCCC | 45.49 | 26026062 | |
| 312 | Phosphorylation | SQPQEDTSPESDIPP CCCCCCCCCCCCCCC | 38.70 | 26824392 | |
| 315 | Phosphorylation | QEDTSPESDIPPPPN CCCCCCCCCCCCCCC | 44.20 | 26745281 | |
| 323 | Phosphorylation | DIPPPPNSSPPGRLQ CCCCCCCCCCCCCCC | 50.42 | 22942356 | |
| 324 | Phosphorylation | IPPPPNSSPPGRLQL CCCCCCCCCCCCCCC | 41.58 | 22942356 | |
| 332 | Phosphorylation | PPGRLQLSPGHKQKE CCCCCCCCCCCCCCC | 18.84 | 26824392 | |
| 354 | Ubiquitination | VPMPYMLKVHYKYTV CCCCEEEEEEEEEEE | 15.50 | - | |
| 357 | Phosphorylation | PYMLKVHYKYTVVME CEEEEEEEEEEEEEE | 14.53 | - | |
| 359 | Phosphorylation | MLKVHYKYTVVMETR EEEEEEEEEEEEEEE | 9.52 | 25367039 | |
| 360 | Phosphorylation | LKVHYKYTVVMETRL EEEEEEEEEEEEEEC | 11.50 | 25367039 | |
| 385 | Phosphorylation | VSKKLALSPEHTKLS HHHHHCCCCCHHCCE | 23.72 | 26745281 | |
| 389 | Phosphorylation | LALSPEHTKLSYRRR HCCCCCHHCCEEECC | 31.83 | 26745281 | |
| 390 | Acetylation | ALSPEHTKLSYRRRD CCCCCHHCCEEECCC | 37.03 | 7631943 | |
| 398 | Phosphorylation | LSYRRRDSHELLLLS CEEECCCHHHEEEEC | 19.63 | 22817900 | |
| 444 | Phosphorylation | EPIQRENSDASKQTT CCCCCCCCCCCCCCC | 29.78 | 30635358 | |
| 513 | Glutathionylation | PKAFVEGCAAKNLEG CHHHHHHHHHHCCCC | 1.79 | 24333276 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NCF2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NCF2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NCF2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PRDX6_MOUSE | Prdx6 | physical | 23401562 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...