UniProt ID | NCF2_MOUSE | |
---|---|---|
UniProt AC | O70145 | |
Protein Name | Neutrophil cytosol factor 2 | |
Gene Name | Ncf2 {ECO:0000312|MGI:MGI:97284} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 525 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production).. | |
Protein Sequence | MSLAEAIRLWNEGVLAADKKDWKGALEAFSEVQDPHSRICFNIGCVNTILENLQAAEQAFTKSINRDKHSAVAYFQRGMLYYRMEKYDLAIKDLKEALTQLRGNQLIDYKILGLQFKLFACEVLYNIALMHAKKEEWKKAEEQLALATNMKSEPRHSKIDKAMESIWKQKLFEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVHQDNFSGFAPLQPQSAEPPPRPKTPEIFRALEGEAHRVLFGFVPETPEELQVMPGNIVFVLKKGSDNWATVMFNGQKGLVPCNYLEPVELRIHPQSQPQEDTSPESDIPPPPNSSPPGRLQLSPGHKQKEPKELKLSVPMPYMLKVHYKYTVVMETRLGLPYSQLRNMVSKKLALSPEHTKLSYRRRDSHELLLLSEESMKDAWGQVKNYCLTLWCEHTVGDQGLIDEPIQRENSDASKQTTEPQPKEGTQVVAIFSYEAAQPEDLEFVEGDVILVLSHVNEEWLEGECKGKVGIFPKAFVEGCAAKNLEGIPREV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
157 | Phosphorylation | MKSEPRHSKIDKAME CCCCCCHHHHHHHHH | 32.36 | 24719451 | |
203 | Phosphorylation | KDYLGKATVVASVVH HCCCCCCEEEEEEEC | 20.99 | 25367039 | |
207 | Phosphorylation | GKATVVASVVHQDNF CCCEEEEEEECCCCC | 17.05 | 25367039 | |
215 | Phosphorylation | VVHQDNFSGFAPLQP EECCCCCCCCCCCCC | 38.98 | 22345495 | |
224 | Phosphorylation | FAPLQPQSAEPPPRP CCCCCCCCCCCCCCC | 41.08 | 26745281 | |
233 | Phosphorylation | EPPPRPKTPEIFRAL CCCCCCCCHHHHHHH | 28.92 | 26824392 | |
291 | S-nitrosocysteine | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | - | |
291 | S-nitrosylation | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | 22178444 | |
291 | Glutathionylation | GQKGLVPCNYLEPVE CCCCEEECCCCEEEE | 4.00 | 24333276 | |
305 | Phosphorylation | ELRIHPQSQPQEDTS EEEECCCCCCCCCCC | 48.56 | 23459991 | |
311 | Phosphorylation | QSQPQEDTSPESDIP CCCCCCCCCCCCCCC | 45.49 | 26026062 | |
312 | Phosphorylation | SQPQEDTSPESDIPP CCCCCCCCCCCCCCC | 38.70 | 26824392 | |
315 | Phosphorylation | QEDTSPESDIPPPPN CCCCCCCCCCCCCCC | 44.20 | 26745281 | |
323 | Phosphorylation | DIPPPPNSSPPGRLQ CCCCCCCCCCCCCCC | 50.42 | 22942356 | |
324 | Phosphorylation | IPPPPNSSPPGRLQL CCCCCCCCCCCCCCC | 41.58 | 22942356 | |
332 | Phosphorylation | PPGRLQLSPGHKQKE CCCCCCCCCCCCCCC | 18.84 | 26824392 | |
354 | Ubiquitination | VPMPYMLKVHYKYTV CCCCEEEEEEEEEEE | 15.50 | - | |
357 | Phosphorylation | PYMLKVHYKYTVVME CEEEEEEEEEEEEEE | 14.53 | - | |
359 | Phosphorylation | MLKVHYKYTVVMETR EEEEEEEEEEEEEEE | 9.52 | 25367039 | |
360 | Phosphorylation | LKVHYKYTVVMETRL EEEEEEEEEEEEEEC | 11.50 | 25367039 | |
385 | Phosphorylation | VSKKLALSPEHTKLS HHHHHCCCCCHHCCE | 23.72 | 26745281 | |
389 | Phosphorylation | LALSPEHTKLSYRRR HCCCCCHHCCEEECC | 31.83 | 26745281 | |
390 | Acetylation | ALSPEHTKLSYRRRD CCCCCHHCCEEECCC | 37.03 | 7631943 | |
398 | Phosphorylation | LSYRRRDSHELLLLS CEEECCCHHHEEEEC | 19.63 | 22817900 | |
444 | Phosphorylation | EPIQRENSDASKQTT CCCCCCCCCCCCCCC | 29.78 | 30635358 | |
513 | Glutathionylation | PKAFVEGCAAKNLEG CHHHHHHHHHHCCCC | 1.79 | 24333276 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NCF2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NCF2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NCF2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRDX6_MOUSE | Prdx6 | physical | 23401562 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...