NB5R1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NB5R1_ARATH
• UniProt AC: Q9ZNT1
• Protein Name: NADH--cytochrome b5 reductase 1
• Gene Name: CBR1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 281
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein .
• Protein Description: Reductase transferring electrons from NADH to cytochrome b5. Required for the NADH-dependent electron transfer involved in the desaturation and hydroxylation of fatty acids and in the desaturation of sterol precursors. No activity with NADPH as electron donor..
• Protein Sequence: MDTEFLRTLDRQILLGVFVAFVAVGAGAAYFLTSSKKRRVCLDPENFKEFKLVKRHQLSHNVAKFVFELPTSTSVLGLPIGQHISCRGKDGQGEDVIKPYTPTTLDSDVGRFELVIKMYPQGRMSHHFREMRVGDHLAVKGPKGRFKYQPGQFRAFGMLAGGSGITPMFQVARAILENPTDKTKVHLIYANVTYDDILLKEELEGLTTNYPEQFKIFYVLNQPPEVWDGGVGFVSKEMIQTHCPAPASDIQILRCGPPPMNKAMAANLEALGYSPEMQFQF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
166	Phosphorylation	LAGGSGITPMFQVAR ECCCCCCCHHHHHHH		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NB5R1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NB5R1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NB5R1_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of NB5R1_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.