NAT8_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAT8_HUMAN
• UniProt AC: Q9UHE5
• Protein Name: N-acetyltransferase 8
• Gene Name: NAT8 {ECO:0000312|HGNC:HGNC:18069}
• Organism: Homo sapiens (Human).
• Sequence Length: 227
• Subcellular Localization: Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein.
• Protein Description: Acetylates the free alpha-amino group of cysteine S-conjugates to form mercapturic acids. [PubMed: 20392701 This is the final step in a major route for detoxification of a wide variety of reactive electrophiles which starts with their incorporation into glutathione S-conjugates. The glutathione S-conjugates are then further processed into cysteine S-conjugates and finally mercapturic acids which are water soluble and can be readily excreted in urine or bile. Alternatively, may have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1]
• Protein Sequence: MAPCHIRKYQESDRQWVVGLLSRGMAEHAPATFRQLLKLPRTLILLLGGPLALLLVSGSWLLALVFSISLFPALWFLAKKPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVDSEHRRQGIAKALVRTVLQFARDQGYSEVILDTGTIQLSAMALYQSMGFKKTGQSFFCVWARLVALHTVHFIYHLPSSKVGSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
83	Phosphorylation	FLAKKPWTEYVDMTL HHHCCCCCCCCCCEE	26.43	29449344
85	Phosphorylation	AKKPWTEYVDMTLCT HCCCCCCCCCCEEEC	8.38	29449344
89	Phosphorylation	WTEYVDMTLCTDMSD CCCCCCCEEECCHHH	17.76	29449344
92	Phosphorylation	YVDMTLCTDMSDITK CCCCEEECCHHHHHH	37.54	29449344
95	Phosphorylation	MTLCTDMSDITKSYL CEEECCHHHHHHHHH	28.77	29449344
98	Phosphorylation	CTDMSDITKSYLSER ECCHHHHHHHHHHHC	20.94	29449344
107	Phosphorylation	SYLSERGSCFWVAES HHHHHCCCEEEEEEC	16.62	28857561
179	Phosphorylation	EVILDTGTIQLSAMA EEEEECCCEEHHHHH	13.98	24719451
183	Phosphorylation	DTGTIQLSAMALYQS ECCCEEHHHHHHHHH	10.30	24719451
221	Phosphorylation	HFIYHLPSSKVGSL- HHHHCCCHHHCCCC-	49.50	28857561
222	Phosphorylation	FIYHLPSSKVGSL-- HHHCCCHHHCCCC--	29.44	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAT8_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAT8_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAT8_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of NAT8_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.