NAT8B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAT8B_HUMAN
• UniProt AC: Q9UHF3
• Protein Name: Putative N-acetyltransferase 8B
• Gene Name: NAT8B {ECO:0000312|HGNC:HGNC:30235}
• Organism: Homo sapiens (Human).
• Sequence Length: 227
• Subcellular Localization: Endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane; Single-pass type II membrane protein. Enriched in the Endoplasmic reticulum-Golgi intermediate compartment.
• Protein Description: May have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1. [PubMed: 24556617 May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons]
• Protein Sequence: MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	Phosphorylation	MAEHAPATFRRLLKL HHHHCHHHHHHHCCC	19.33	-
91	Methylation	RYVDIALRTDMSDIT HHHHHHEECCHHHHH	21.47	115484519
92	Phosphorylation	YVDIALRTDMSDITK HHHHHEECCHHHHHH	36.58	29083192
95	Phosphorylation	IALRTDMSDITKSYL HHEECCHHHHHHHHH	28.77	29083192
98	Phosphorylation	RTDMSDITKSYLSEC ECCHHHHHHHHHHHC	20.94	29083192
107	Phosphorylation	SYLSECGSCFWVAES HHHHHCCCCEEEEEC	20.14	28857561

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAT8B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAT8B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAT8B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of NAT8B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.