UniProt ID | NAT8B_HUMAN | |
---|---|---|
UniProt AC | Q9UHF3 | |
Protein Name | Putative N-acetyltransferase 8B | |
Gene Name | NAT8B {ECO:0000312|HGNC:HGNC:30235} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization |
Endoplasmic reticulum-Golgi intermediate compartment membrane Single-pass type II membrane protein. Endoplasmic reticulum membrane Single-pass type II membrane protein. Enriched in the Endoplasmic reticulum-Golgi intermediate compartment. |
|
Protein Description | May have a lysine N-acetyltransferase activity catalyzing peptidyl-lysine N6-acetylation of various proteins. Thereby, may regulate apoptosis through the acetylation and the regulation of the expression of PROM1. [PubMed: 24556617 May also regulate amyloid beta-peptide secretion through acetylation of BACE1 and the regulation of its expression in neurons] | |
Protein Sequence | MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSWILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNIQLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
32 | Phosphorylation | MAEHAPATFRRLLKL HHHHCHHHHHHHCCC | 19.33 | - | |
91 | Methylation | RYVDIALRTDMSDIT HHHHHHEECCHHHHH | 21.47 | 115484519 | |
92 | Phosphorylation | YVDIALRTDMSDITK HHHHHEECCHHHHHH | 36.58 | 29083192 | |
95 | Phosphorylation | IALRTDMSDITKSYL HHEECCHHHHHHHHH | 28.77 | 29083192 | |
98 | Phosphorylation | RTDMSDITKSYLSEC ECCHHHHHHHHHHHC | 20.94 | 29083192 | |
107 | Phosphorylation | SYLSECGSCFWVAES HHHHHCCCCEEEEEC | 20.14 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAT8B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAT8B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAT8B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NAT8B_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...