NAPEP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAPEP_HUMAN
• UniProt AC: Q6IQ20
• Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D {ECO:0000303|PubMed:25684574}
• Gene Name: NAPEPLD
• Organism: Homo sapiens (Human).
• Sequence Length: 393
• Subcellular Localization: Golgi apparatus membrane ; Peripheral membrane protein . Early endosome membrane ; Peripheral membrane protein . Nucleus envelope . Nucleus, nucleoplasm . Localized in the proximity of the cellular membranes likely through interaction with membrane p
• Protein Description: Hydrolyzes N-acyl-phosphatidylethanolamines (NAPEs) to produce N-acylethanolamines (NAEs) and phosphatidic acid. [PubMed: 25684574]
• Protein Sequence: MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDENESNQ -------CCCCHHHH	15.28	22814378
6	Phosphorylation	--MDENESNQSLMTS --CCCCHHHHHHHHC	52.32	25693802
9	Phosphorylation	DENESNQSLMTSSQY CCCHHHHHHHHCCCC	25.10	25954137
12	Phosphorylation	ESNQSLMTSSQYPKE HHHHHHHHCCCCCHH	30.44	25954137
13	Phosphorylation	SNQSLMTSSQYPKEA HHHHHHHCCCCCHHH	11.07	29978859
14	Phosphorylation	NQSLMTSSQYPKEAV HHHHHHCCCCCHHHH	25.27	25954137
16	Phosphorylation	SLMTSSQYPKEAVRK HHHHCCCCCHHHHHH	20.44	25954137
18	Ubiquitination	MTSSQYPKEAVRKRQ HHCCCCCHHHHHHHH	54.06	24816145
36	Phosphorylation	RNSGASDSSRFSRKS HHCCCCCCHHHHHHH	22.40	27251275
37	Phosphorylation	NSGASDSSRFSRKSF HCCCCCCHHHHHHHH	42.19	27251275
40	Phosphorylation	ASDSSRFSRKSFKLD CCCCHHHHHHHHHCE	37.37	27251275
43	Phosphorylation	SSRFSRKSFKLDYRL CHHHHHHHHHCEEEE	26.89	22617229
59	Methylation	EDVTKSKKGKDGRFV HCHHCCCCCCCCCCC	77.58	116252951
73	Ubiquitination	VNPWPTWKNPSIPNV CCCCCCCCCCCHHHH	62.55	23000965
91	Phosphorylation	LIMEKDHSSVPSSKE HHHCCCCCCCCCCHH	43.07	30576142
91	Ubiquitination	LIMEKDHSSVPSSKE HHHCCCCCCCCCCHH	43.07	24816145
97	Neddylation	HSSVPSSKEELDKEL CCCCCCCHHHHHHCC	60.59	32015554
97	Ubiquitination	HSSVPSSKEELDKEL CCCCCCCHHHHHHCC	60.59	21906983
102	Ubiquitination	SSKEELDKELPVLKP CCHHHHHHCCCCCCC	74.01	21906983
146	Ubiquitination	MDELIFLTDPIFSSR CCCEEEEECCCCCCC	29.04	21890473
239	Ubiquitination	WWEENCVPGHDKVTF EEHHHCCCCCCCEEE	36.28	30230243
281	Ubiquitination	GPWNRFFFAGDTGYC CCCCCEEECCCCCCC	7.35	30230243
296	Ubiquitination	PAFEEIGKRFGPFDL HHHHHHHHHHCCCCE	50.65	30230243
318	Ubiquitination	YEPRWFMKYQHVDPE CCCCEEEEECCCCHH	32.08	30230243
360	Ubiquitination	HYLEPPVKLNEALER CCCCCCCCHHHHHHH	51.90	30230243

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAPEP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAPEP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAPEP_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of NAPEP_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.