UniProt ID | NANO3_MOUSE | |
---|---|---|
UniProt AC | P60324 | |
Protein Name | Nanos homolog 3 | |
Gene Name | Nanos3 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 178 | |
Subcellular Localization | Nucleus . Cytoplasm . Cytoplasm, Stress granule . Cytoplasm, P-body . Co-localizes with PUM2, EIF2S1 and TIAL1 in the stress granules. Co-localizes with DCP1A in the P-body. | |
Protein Description | Plays a role in the maintenance of the undifferentiated state of germ cells regulating the spermatogonia cell cycle and inducing a prolonged transit in G1 phase. Affects cell proliferation probably by repressing translation of specific mRNAs. Maintains the germ cell lineage by suppressing both Bax-dependent and -independent apoptotic pathways. Essential in the early stage embryo to protect the migrating primordial germ cells (PGCs) from apoptosis.. | |
Protein Sequence | MGTFNLWTDYLGLARLVGALHKEEELDVRLDPKPEPKPSSESQQASKESSAAPERLCSFCKHNGESRAIYQSHVLKDEAGRVLCPILRDYVCPQCGATQEHAHTRRFCPLTSQGYTSVYCYTTRNSAGKKLTRPDKAKTQDAGHRLGGEAAAGVYAGSKSGRKPPGPSPSACCPSTTA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NANO3_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NANO3_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NANO3_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NANO2_MOUSE | Nanos2 | genetic | 17138666 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...