dbPTM

NACA4_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NACA4_ARATH
UniProt AC	Q9SZY1
Protein Name	Nascent polypeptide-associated complex subunit alpha-like protein 4
Gene Name	At4g10480
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	212
Subcellular Localization
Protein Description	May promote appropriate targeting of ribosome-nascent polypeptide complexes..
Protein Sequence	MPGPVIEEVNEEALMDAIKEQMKLQKENDVVVEDVKDGDEDDDDVDDDDDEIADGAGENEASKQSRSEKKSRKAMLKLGMKPVTDVSRVTIKRSKNVLFVISKPDVFKSPNSETYVIFGEAKIDDMSSQLQAQAAQRFKMPDVASMIPNTDGSEAATVAQEEEDDEDVDETGVEAKDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELTT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Sulfoxidation	EVNEEALMDAIKEQM HCCHHHHHHHHHHHH	4.16	23289948
22	Sulfoxidation	MDAIKEQMKLQKEND HHHHHHHHHHHHCCC	4.99	23289948
126	Sulfoxidation	GEAKIDDMSSQLQAQ EEEECCHHHHHHHHH	3.54	23289948
127	Phosphorylation	EAKIDDMSSQLQAQA EEECCHHHHHHHHHH	23.17	30407730
128	Phosphorylation	AKIDDMSSQLQAQAA EECCHHHHHHHHHHH	28.42	30407730
140	Sulfoxidation	QAAQRFKMPDVASMI HHHHHCCCCCHHHCC	2.93	23289948
145	Phosphorylation	FKMPDVASMIPNTDG CCCCCHHHCCCCCCC	19.66	23776212
146	Sulfoxidation	KMPDVASMIPNTDGS CCCCHHHCCCCCCCC	4.21	23289948
150	Phosphorylation	VASMIPNTDGSEAAT HHHCCCCCCCCCCCH	36.06	23776212
153	Phosphorylation	MIPNTDGSEAATVAQ CCCCCCCCCCCHHCC	27.20	23776212
157	Phosphorylation	TDGSEAATVAQEEED CCCCCCCHHCCHHCC	24.34	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NACA4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NACA4_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NACA4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NACA4_ARATH

Related Literatures of Post-Translational Modification