UniProt ID | NAC8_ARATH | |
---|---|---|
UniProt AC | Q6NQK2 | |
Protein Name | SUPPRESSOR OF GAMMA RESPONSE 1 {ECO:0000303|PubMed:19549833} | |
Gene Name | SOG1 {ECO:0000303|PubMed:19549833} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 449 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor regulating the transcriptional activation response to gamma irradiation. [PubMed: 19549833 Required for stem-cell death induced by UVB or by gamma irradiation] | |
Protein Sequence | MAGRSWLIDSNRIATKIMSASASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGTRKRRKIHDDDFGDVRWHKTGRTKPVVLDGVQRGCKKIMVLYGGKAVKTNWVMHQYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLATPEPRNAVRICSDSHIASDYVTPSDYVSAHEVSLAETSEVMCMEDEVQSIQPNHERPSSGPELEHGLENGAKEMLDDKEEQEKDRDNENQGEEDPTWFDSGSQFILNSQQLVEALSLCDDLLGSQDREENTNSGSLKDKQPCIADYAHLGPEDFKRDLEECQKIVLDPSNIELDTPPEFRLSQLEFGSQDSFLAWGTGKTD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
176 | Phosphorylation | CKKIMVLYGGKAVKT CCEEEEEECCEEHHC | 16.66 | 28295753 | |
229 | Phosphorylation | DKAEQEVSEDIFAAV CHHHHHHCHHHHHHH | 28.88 | 30407730 | |
237 | Phosphorylation | EDIFAAVTPTADPVT HHHHHHHCCCCCCCC | 15.36 | 30407730 | |
239 | Phosphorylation | IFAAVTPTADPVTPK HHHHHCCCCCCCCCC | 34.04 | 30407730 | |
244 | Phosphorylation | TPTADPVTPKLATPE CCCCCCCCCCCCCCC | 21.79 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAC8_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAC8_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAC8_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of NAC8_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...