dbPTM

NAC8_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NAC8_ARATH
UniProt AC	Q6NQK2
Protein Name	SUPPRESSOR OF GAMMA RESPONSE 1 {ECO:0000303\|PubMed:19549833}
Gene Name	SOG1 {ECO:0000303\|PubMed:19549833}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	449
Subcellular Localization	Nucleus .
Protein Description	Transcription factor regulating the transcriptional activation response to gamma irradiation. [PubMed: 19549833 Required for stem-cell death induced by UVB or by gamma irradiation]
Protein Sequence	MAGRSWLIDSNRIATKIMSASASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGTRKRRKIHDDDFGDVRWHKTGRTKPVVLDGVQRGCKKIMVLYGGKAVKTNWVMHQYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLATPEPRNAVRICSDSHIASDYVTPSDYVSAHEVSLAETSEVMCMEDEVQSIQPNHERPSSGPELEHGLENGAKEMLDDKEEQEKDRDNENQGEEDPTWFDSGSQFILNSQQLVEALSLCDDLLGSQDREENTNSGSLKDKQPCIADYAHLGPEDFKRDLEECQKIVLDPSNIELDTPPEFRLSQLEFGSQDSFLAWGTGKTD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
176	Phosphorylation	CKKIMVLYGGKAVKT CCEEEEEECCEEHHC	16.66	28295753
229	Phosphorylation	DKAEQEVSEDIFAAV CHHHHHHCHHHHHHH	28.88	30407730
237	Phosphorylation	EDIFAAVTPTADPVT HHHHHHHCCCCCCCC	15.36	30407730
239	Phosphorylation	IFAAVTPTADPVTPK HHHHHCCCCCCCCCC	34.04	30407730
244	Phosphorylation	TPTADPVTPKLATPE CCCCCCCCCCCCCCC	21.79	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NAC8_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NAC8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NAC8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of NAC8_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NAC8_ARATH

Related Literatures of Post-Translational Modification