NAA20_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NAA20_MOUSE
• UniProt AC: P61600
• Protein Name: N-alpha-acetyltransferase 20
• Gene Name: Naa20
• Organism: Mus musculus (Mouse).
• Sequence Length: 178
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Catalytic subunit of the NatB complex which catalyzes acetylation of the N-terminal methionine residues of peptides beginning with Met-Asp, Met-Glu, Met-Asn and Met-Gln. Proteins with cell cycle functions are overrepresented in the pool of NatB substrates. Required for maintaining the structure and function of actomyosin fibers and for proper cellular migration..
• Protein Sequence: MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSIIPLPHPVRPEDIE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Phosphorylation	MELLEEISERKGGFF HHHHHHHHHHCCCEE	34.33	23140645

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NAA20_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NAA20_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NAA20_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NAA20_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.