dbPTM

MYP0_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MYP0_MOUSE
UniProt AC	P27573
Protein Name	Myelin protein P0
Gene Name	Mpz
Organism	Mus musculus (Mouse).
Sequence Length	248
Subcellular Localization	Cell membrane Single-pass type I membrane protein .
Protein Description	Is an adhesion molecule necessary for normal myelination in the peripheral nervous system. It mediates adhesion between adjacent myelin wraps and ultimately drives myelin compaction..
Protein Sequence	MAPGAPSSSPSPILAALLFSSLVLSPALAIVVYTDREIYGAVGSQVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGAFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGILGVVLLLLLLFYLIRYCWLRRQAALQRRLSAMEKGRFHKSSKDSSKRGRQTPVLYAMLDHSRSTKAASEKKSKGLGESRKDKK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
96	Ubiquitination	IDEVGAFKERIQWVG CCCCCHHHHHEEECC	45.62	-
122	N-linked_Glycosylation	HNLDYSDNGTFTCDV EECCCCCCCEEEEEC	45.52	-
195	Phosphorylation	AALQRRLSAMEKGRF HHHHHHHHHHHHCCC	24.61	23737553
205	Phosphorylation	EKGRFHKSSKDSSKR HHCCCCCCCCCCHHC	33.77	7530295
210	Phosphorylation	HKSSKDSSKRGRQTP CCCCCCCHHCCCCCH	36.18	7530295
216	Phosphorylation	SSKRGRQTPVLYAML CHHCCCCCHHHHHHH	17.63	22817900
220	Phosphorylation	GRQTPVLYAMLDHSR CCCCHHHHHHHHCCH	7.09	28464351
226	Phosphorylation	LYAMLDHSRSTKAAS HHHHHHCCHHHHHHH	27.82	7530295
228	Phosphorylation	AMLDHSRSTKAASEK HHHHCCHHHHHHHHH	36.96	7530295
233	Phosphorylation	SRSTKAASEKKSKGL CHHHHHHHHHHHCCC	55.60	7530295
237	Phosphorylation	KAASEKKSKGLGESR HHHHHHHHCCCCCCC	42.92	7530295
243	Phosphorylation	KSKGLGESRKDKK-- HHCCCCCCCCCCC--	42.71	7530295

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
210	S	Phosphorylation	Kinase	PKC	-	Uniprot
233	S	Phosphorylation	Kinase	PKC	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MYP0_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MYP0_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MYP0_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MYP0_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry."; Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.; J. Proteome Res. 7:5314-5326(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-216 AND SER-243, ANDMASS SPECTROMETRY.	19367708 [Abstract]
"Myelin P0 glycoprotein: identification of the site phosphorylated invitro and in vivo by endogenous protein kinases."; Hilmi S., Fournier M., Valeins H., Gandar J.C., Bonnet J.; J. Neurochem. 64:902-907(1995). Cited for: PHOSPHORYLATION AT SER-226; SER-228; SER-233; SER-237 AND SER-243.	7530295 [Abstract]