| UniProt ID | MYL6B_MOUSE | |
|---|---|---|
| UniProt AC | Q8CI43 | |
| Protein Name | Myosin light chain 6B | |
| Gene Name | Myl6b {ECO:0000312|EMBL:AAH37527.1, ECO:0000312|MGI:MGI:1917789} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 207 | |
| Subcellular Localization | ||
| Protein Description | Regulatory light chain of myosin. Does not bind calcium.. | |
| Protein Sequence | MPPKKDAPVKKPAGPSISKPAAKSTPGTPLAKAKAEPAAPQAPAKSQEPPVDLSKVVIEFNKDQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFLPMLQAVAKNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Phosphorylation | VKKPAGPSISKPAAK CCCCCCCCCCCCCCC | 38.28 | 22871156 | |
| 24 | Phosphorylation | ISKPAAKSTPGTPLA CCCCCCCCCCCCCHH | 34.80 | 24899341 | |
| 25 | Phosphorylation | SKPAAKSTPGTPLAK CCCCCCCCCCCCHHH | 25.65 | 22871156 | |
| 28 | Phosphorylation | AAKSTPGTPLAKAKA CCCCCCCCCHHHHCC | 19.14 | 24719451 | |
| 86 | Phosphorylation | GDGKILYSQCGDLMR CCCCEEEHHHHHHHH | 18.62 | - | |
| 100 | Phosphorylation | RALGQNPTNAEVLKV HHHCCCCCCHHHHHH | 55.39 | - | |
| 106 | Acetylation | PTNAEVLKVLGNPKN CCCHHHHHHHCCCCC | 40.36 | 22638941 | |
| 106 | Ubiquitination | PTNAEVLKVLGNPKN CCCHHHHHHHCCCCC | 40.36 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYL6B_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYL6B_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYL6B_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MYL6B_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...