UniProt ID | MYL6B_MOUSE | |
---|---|---|
UniProt AC | Q8CI43 | |
Protein Name | Myosin light chain 6B | |
Gene Name | Myl6b {ECO:0000312|EMBL:AAH37527.1, ECO:0000312|MGI:MGI:1917789} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 207 | |
Subcellular Localization | ||
Protein Description | Regulatory light chain of myosin. Does not bind calcium.. | |
Protein Sequence | MPPKKDAPVKKPAGPSISKPAAKSTPGTPLAKAKAEPAAPQAPAKSQEPPVDLSKVVIEFNKDQLEEFREAFELFDRVGDGKILYSQCGDLMRALGQNPTNAEVLKVLGNPKNEELKSRRVDFETFLPMLQAVAKNRDQGTYEDYLEGLRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
16 | Phosphorylation | VKKPAGPSISKPAAK CCCCCCCCCCCCCCC | 38.28 | 22871156 | |
24 | Phosphorylation | ISKPAAKSTPGTPLA CCCCCCCCCCCCCHH | 34.80 | 24899341 | |
25 | Phosphorylation | SKPAAKSTPGTPLAK CCCCCCCCCCCCHHH | 25.65 | 22871156 | |
28 | Phosphorylation | AAKSTPGTPLAKAKA CCCCCCCCCHHHHCC | 19.14 | 24719451 | |
86 | Phosphorylation | GDGKILYSQCGDLMR CCCCEEEHHHHHHHH | 18.62 | - | |
100 | Phosphorylation | RALGQNPTNAEVLKV HHHCCCCCCHHHHHH | 55.39 | - | |
106 | Acetylation | PTNAEVLKVLGNPKN CCCHHHHHHHCCCCC | 40.36 | 22638941 | |
106 | Ubiquitination | PTNAEVLKVLGNPKN CCCHHHHHHHCCCCC | 40.36 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYL6B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYL6B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYL6B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MYL6B_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...