UniProt ID | MYL1_RAT | |
---|---|---|
UniProt AC | P02600 | |
Protein Name | Myosin light chain 1/3, skeletal muscle isoform | |
Gene Name | Myl1 | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 189 | |
Subcellular Localization | ||
Protein Description | Regulatory light chain of myosin. Does not bind calcium.. | |
Protein Sequence | MAPKKDVKKPAAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEEFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Methylation | ------MAPKKDVKK ------CCCHHHCCC | 25.31 | - | |
2 (in isoform 2) | Acetylation | - | 25.31 | - | |
2 (in isoform 2) | Phosphorylation | - | 25.31 | 22673903 | |
27 | Acetylation | APAPAPAKPKEEKID CCCCCCCCCCHHHCC | 56.41 | 22902405 | |
36 | Phosphorylation | KEEKIDLSAIKIEFS CHHHCCHHHEECEEC | 24.97 | 22673903 | |
39 | Acetylation | KIDLSAIKIEFSKEQ HCCHHHEECEECHHH | 35.58 | 22902405 | |
44 | Acetylation | AIKIEFSKEQQEEFK HEECEECHHHHHHHH | 65.93 | 26302492 | |
51 | Acetylation | KEQQEEFKEAFLLFD HHHHHHHHHHHHHHC | 51.95 | 22902405 | |
64 | Acetylation | FDRTGECKITLSQVG HCCCCCCEEEHHHHH | 34.13 | 22902405 | |
66 | Phosphorylation | RTGECKITLSQVGDV CCCCCEEEHHHHHHH | 13.07 | 22673903 | |
68 | Phosphorylation | GECKITLSQVGDVLR CCCEEEHHHHHHHHH | 17.73 | 22673903 | |
82 | Phosphorylation | RALGTNPTNAEVKKV HHHCCCCCCHHHHHH | 49.48 | 22673903 | |
87 | Acetylation | NPTNAEVKKVLGNPS CCCCHHHHHHHCCCC | 28.77 | 22902405 | |
94 | Phosphorylation | KKVLGNPSNEEMNAK HHHHCCCCCHHHHHH | 61.96 | 22673903 | |
101 | Acetylation | SNEEMNAKKIEFEQF CCHHHHHHHHCHHHH | 49.64 | 22902405 | |
102 | Acetylation | NEEMNAKKIEFEQFL CHHHHHHHHCHHHHH | 45.09 | 22902405 | |
119 | Acetylation | MQAISNNKDQGGYED HHHHHCCCCCCCCHH | 56.53 | 22902405 | |
136 | Acetylation | EGLRVFDKEGNGTVM HEEEEEEECCCCEEE | 56.93 | 22902405 | |
141 | Phosphorylation | FDKEGNGTVMGAELR EEECCCCEEEHHHHH | 16.00 | 22673903 | |
157 | Ubiquitination | VLATLGEKMKEEEVE HHHHHHHHHCHHHHH | 54.17 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYL1_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYL1_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYL1_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MYL1_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...