| UniProt ID | MYEF2_MOUSE | |
|---|---|---|
| UniProt AC | Q8C854 | |
| Protein Name | Myelin expression factor 2 | |
| Gene Name | Myef2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 591 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Transcriptional repressor of the myelin basic protein gene (MBP). Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.. | |
| Protein Sequence | MADADKSEAAAGDDGSQQQPAEPRRDTHPGEPEKPPRSSANGVKMENDESVKEEKSDLKEKSTGNKKANRFHPYSKDKNSGTGEKKGPNRNRVFISNIPYDMKWQAIKDLMREKVGEVTYVELFKDAEGKSRGCGVVEFKDEEFVKKALETMNKYDLSGRPLNIKEDPDGENARRALQRTGTSFQGSHASDVGSGLVNLPPSILNNPNIPPEVISNLQAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMGTVTFEQAIEAVQAISMFNGQFLFDRPMHVKMDDKSVPHEDYRSHDSKTSQLPRGLGGIGMGLGPGGQPISASQLNITGVMGNLGPSGMGMDGPGFGGVNRIGGGVGFGGLEAMNSMAGFGGVGRMGELYRGAMTSSMERDFGRGDIGLSRGFGDSFGRLGSAMIGGFAGRIGASNMGPVGTGISGSMSGMSTVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDVDRGFLSGPMGSGMRDRLGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFESAESAEKACRIMNGIKISGREIDVRLDRNA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Phosphorylation | -MADADKSEAAAGDD -CCCCHHHHHHCCCC | 32.77 | 24759943 | |
| 16 | Phosphorylation | AAAGDDGSQQQPAEP HHCCCCCCCCCCCCC | 31.63 | 27087446 | |
| 27 | Phosphorylation | PAEPRRDTHPGEPEK CCCCCCCCCCCCCCC | 28.32 | 23684622 | |
| 50 | Phosphorylation | VKMENDESVKEEKSD CCCCCCHHHHHHHHH | 41.16 | 27841257 | |
| 108 | Ubiquitination | DMKWQAIKDLMREKV HHHHHHHHHHHHHHC | 48.07 | 22790023 | |
| 158 | Phosphorylation | TMNKYDLSGRPLNIK HCCCCCCCCCCCCCC | 29.83 | 30387612 | |
| 225 | Phosphorylation | QAGRLGSTIFVANLD CCCCCCCEEEEEECC | 19.35 | - | |
| 353 (in isoform 3) | Phosphorylation | - | 39.34 | - | |
| 396 (in isoform 2) | Phosphorylation | - | 11.60 | 29895711 | |
| 397 | Methylation | GRMGELYRGAMTSSM HHHHHHHHHHHCCCC | 38.73 | 24129315 | |
| 401 | Phosphorylation | ELYRGAMTSSMERDF HHHHHHHCCCCCCCC | 19.67 | 30635358 | |
| 402 | Phosphorylation | LYRGAMTSSMERDFG HHHHHHCCCCCCCCC | 18.01 | 30635358 | |
| 403 | Phosphorylation | YRGAMTSSMERDFGR HHHHHCCCCCCCCCC | 18.59 | 30635358 | |
| 410 | Methylation | SMERDFGRGDIGLSR CCCCCCCCCCCCCCC | 39.34 | 16187603 | |
| 417 | Methylation | RGDIGLSRGFGDSFG CCCCCCCCCCCCCCH | 49.88 | 24129315 | |
| 422 | Phosphorylation | LSRGFGDSFGRLGSA CCCCCCCCCHHHHHH | 29.94 | 23684622 | |
| 473 | Phosphorylation | MGLDRMSSSFDRMGP CCHHHHCCCCHHCCC | 26.19 | 21183079 | |
| 474 | Phosphorylation | GLDRMSSSFDRMGPG CHHHHCCCCHHCCCC | 24.70 | 21183079 | |
| 489 | Phosphorylation | IGAILERSIDVDRGF HHHHHHEECCCCCCC | 17.48 | 24719451 | |
| 511 | Phosphorylation | GMRDRLGSKGNQIFV CHHHHHCCCCCEEEE | 41.82 | 25159016 | |
| 529 | Ubiquitination | PFDLTWQKLKEKFSQ CCCCCHHHHHHHHHH | 53.76 | 22790023 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYEF2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYEF2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYEF2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MYEF2_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
