UniProt ID | MYCT1_MOUSE | |
---|---|---|
UniProt AC | Q8R411 | |
Protein Name | Myc target protein 1 | |
Gene Name | Myct1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 188 | |
Subcellular Localization |
Nucleus membrane Single-pass membrane protein . |
|
Protein Description | May regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. Does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability and inhibition of hematopoietic differentiation.. | |
Protein Sequence | MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSPTRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFHPFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYESIIKAFPDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | LSRRRRASAPISQWS HHHHHHCCCCHHHCC | 32.53 | 22324799 | |
56 | Phosphorylation | RRASAPISQWSPTRR HHCCCCHHHCCCCCC | 25.25 | 22345495 | |
59 | Phosphorylation | SAPISQWSPTRRPRS CCCHHHCCCCCCCCC | 14.57 | 28542873 | |
61 | Phosphorylation | PISQWSPTRRPRSSY CHHHCCCCCCCCCHH | 33.52 | 25159016 | |
66 | Phosphorylation | SPTRRPRSSYNHGLN CCCCCCCCHHCCCCC | 39.60 | 22817900 | |
67 | Phosphorylation | PTRRPRSSYNHGLNR CCCCCCCHHCCCCCC | 31.10 | 22817900 | |
68 | Phosphorylation | TRRPRSSYNHGLNRT CCCCCCHHCCCCCCC | 16.66 | - | |
81 | Phosphorylation | RTGFYRHSGYERRSN CCCCCCCCCCCCCCC | 33.79 | 24719451 | |
87 | Phosphorylation | HSGYERRSNLSLASL CCCCCCCCCCCHHHH | 48.63 | 25521595 | |
90 | Phosphorylation | YERRSNLSLASLTFQ CCCCCCCCHHHHHHH | 26.58 | 25521595 | |
93 | Phosphorylation | RSNLSLASLTFQRQA CCCCCHHHHHHHHHH | 32.98 | 21082442 | |
95 | Phosphorylation | NLSLASLTFQRQASM CCCHHHHHHHHHHHH | 18.41 | 23737553 | |
101 | Phosphorylation | LTFQRQASMELVNSF HHHHHHHHHHHHHCC | 12.40 | 25521595 | |
107 | Phosphorylation | ASMELVNSFPRKSSF HHHHHHHCCCCCCCC | 29.19 | 22817900 | |
153 | Phosphorylation | STLSTAHSPSRPDFR CHHHCCCCCCCCCCC | 23.31 | 23649490 | |
155 | Phosphorylation | LSTAHSPSRPDFRWS HHCCCCCCCCCCCCC | 60.50 | 23649490 | |
162 | Phosphorylation | SRPDFRWSSNSLRMG CCCCCCCCCCCCCCC | 18.52 | 27180971 | |
163 | Phosphorylation | RPDFRWSSNSLRMGL CCCCCCCCCCCCCCC | 24.39 | 23737553 | |
165 | Phosphorylation | DFRWSSNSLRMGLST CCCCCCCCCCCCCCC | 21.21 | 27180971 | |
171 | Phosphorylation | NSLRMGLSTPPPPAY CCCCCCCCCCCCCHH | 32.89 | 23649490 | |
172 | Phosphorylation | SLRMGLSTPPPPAYE CCCCCCCCCCCCHHH | 44.87 | 26745281 | |
178 | Phosphorylation | STPPPPAYESIIKAF CCCCCCHHHHHHHHC | 18.91 | 23140645 | |
180 | Phosphorylation | PPPPAYESIIKAFPD CCCCHHHHHHHHCCC | 19.55 | 23140645 | |
183 | Ubiquitination | PAYESIIKAFPDS-- CHHHHHHHHCCCC-- | 42.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYCT1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYCT1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYCT1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MYCT1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...