dbPTM

MUG69_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MUG69_SCHPO
UniProt AC	O14193
Protein Name	SRP-independent targeting protein 2 homolog {ECO:0000250\|UniProtKB:Q99382}
Gene Name	mug69 {ECO:0000303\|PubMed:16303567}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	192
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	May function in a SRP (signal recognition particle) and GET (guided entry of tail-anchored proteins) independent pathway for targeting a broad range of substrate proteins to the endoplasmic reticulum (By similarity). Has a role in meiosis. [PubMed: 16303567]
Protein Sequence	MANAAQKKLAAQNKHILTFMLAADLIVNVLFWILRFFVRSGLSKFSKFVYAFASISSGFLHYQLHRAAAPKYDARGSLLYVGQDLLQEGVTSYMVDYMYFSWILIFLAALTSVKVFAFYLLVPIFVVYKAAPLLKMLLQQLKNFKNQALNQPPQQQQQQQQQQHQQHATPSEPVLSKRQQKLRKKAAKYSRP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MUG69_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MUG69_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MUG69_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MUG69_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MUG69_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MUG69_SCHPO

Related Literatures of Post-Translational Modification