MUG58_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUG58_SCHPO
• UniProt AC: Q9UUH3
• Protein Name: Uncharacterized kinase mug58
• Gene Name: mug58
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 277
• Subcellular Localization: Cytoplasm. Nucleus.
• Protein Description: Has a role in meiosis..
• Protein Sequence: MSSLEIIVDKILKFLEKQPKPEGRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDDFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVLNAFVKGSDEEVSIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIFEGWMVGFEPLDSCMLSVRARSTRWQNIEGSLLWVNRKLADYQPIFQKIDSLVELEAQEINYVYRWRLQQEHALKARIHKGMSDEEVIEFVNHYMPQYVFYLGTLSNKVHLNPHCLEIILDENRYPVVMH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of MUG58_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUG58_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUG58_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUG58_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YFE6_SCHPO	gmh5	genetic	18818364
IDHP_SCHPO	idp1	genetic	22681890
6PGL_SCHPO	SPCC16C4.10	genetic	22681890
CTBL1_SCHPO	SPAC1952.06c	genetic	22681890
PLB2_SCHPO	SPAC1A6.03c	genetic	22681890
PNPP_SCHPO	pho2	genetic	22681890
LIZ1_SCHPO	liz1	genetic	22681890
YII1_SCHPO	SPAC139.01c	genetic	22681890
IWR1_SCHPO	iwr1	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.