| UniProt ID | MUG31_SCHPO | |
|---|---|---|
| UniProt AC | Q9US56 | |
| Protein Name | Meiotically up-regulated gene 31 protein | |
| Gene Name | mug31 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 229 | |
| Subcellular Localization | Endoplasmic reticulum . | |
| Protein Description | Has a role in meiosis.. | |
| Protein Sequence | MASTFSQSVFARSLYEDSAENKVDSSKNTEANFPITLPKVLPTDPKASSLHKPQEQQPNIIPSKEEDKKPVINSMKLPSIPAPGTDNINESHIPRGYWKHPAVDKIAKRLHDQAPSDRTWSRMVSNLFAFISIQFLNRYLPNTTAVKVVSWILQALLLFNLLESVWQFVRPQPTFDDLQLTPLQRKLMGLPEGGSTSGKHLTPPRYRPNFSPSRKAENVKSPVRSTTWA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | Phosphorylation | --MASTFSQSVFARS --CCCCCCHHHHHHH | 22.95 | 24763107 | |
| 13 | Phosphorylation | SQSVFARSLYEDSAE CHHHHHHHHHCHHHH | 31.69 | 24763107 | |
| 48 | Phosphorylation | LPTDPKASSLHKPQE CCCCCCHHHCCCCHH | 39.29 | 21712547 | |
| 49 | Phosphorylation | PTDPKASSLHKPQEQ CCCCCHHHCCCCHHH | 39.08 | 24763107 | |
| 211 | Phosphorylation | PRYRPNFSPSRKAEN CCCCCCCCHHHCCCC | 28.71 | 29996109 | |
| 213 | Phosphorylation | YRPNFSPSRKAENVK CCCCCCHHHCCCCCC | 45.26 | 29996109 | |
| 221 | Phosphorylation | RKAENVKSPVRSTTW HCCCCCCCCCCCCCC | 25.09 | 24763107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MUG31_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MUG31_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MUG31_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MUG31_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...