MUG31_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MUG31_SCHPO
• UniProt AC: Q9US56
• Protein Name: Meiotically up-regulated gene 31 protein
• Gene Name: mug31
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 229
• Subcellular Localization: Endoplasmic reticulum .
• Protein Description: Has a role in meiosis..
• Protein Sequence: MASTFSQSVFARSLYEDSAENKVDSSKNTEANFPITLPKVLPTDPKASSLHKPQEQQPNIIPSKEEDKKPVINSMKLPSIPAPGTDNINESHIPRGYWKHPAVDKIAKRLHDQAPSDRTWSRMVSNLFAFISIQFLNRYLPNTTAVKVVSWILQALLLFNLLESVWQFVRPQPTFDDLQLTPLQRKLMGLPEGGSTSGKHLTPPRYRPNFSPSRKAENVKSPVRSTTWA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MASTFSQSVFARS --CCCCCCHHHHHHH	22.95	24763107
13	Phosphorylation	SQSVFARSLYEDSAE CHHHHHHHHHCHHHH	31.69	24763107
48	Phosphorylation	LPTDPKASSLHKPQE CCCCCCHHHCCCCHH	39.29	21712547
49	Phosphorylation	PTDPKASSLHKPQEQ CCCCCHHHCCCCHHH	39.08	24763107
211	Phosphorylation	PRYRPNFSPSRKAEN CCCCCCCCHHHCCCC	28.71	29996109
213	Phosphorylation	YRPNFSPSRKAENVK CCCCCCHHHCCCCCC	45.26	29996109
221	Phosphorylation	RKAENVKSPVRSTTW HCCCCCCCCCCCCCC	25.09	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MUG31_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MUG31_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MUG31_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of MUG31_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.