dbPTM

MU191_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MU191_SCHPO
UniProt AC	O14131
Protein Name	Meiotically up-regulated gene 191 protein
Gene Name	mug191
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	442
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Has a role in meiosis..
Protein Sequence	MSENVYLNEALNVVDQCFKTFFDKYTDRMGSAFACSGTIDKDHIFLVWSVAVYAEAMADSLRYTSKFERKFEHVFQALKKYWSPVFNACCAFHYFEGNDDVYYDDNAQVAIGLATAGYYTTNSSRRDHYVSRAESIISLIINKGWNQQRGGIAWHTRTTGPPWTNLNACSTSMSAVAALRLALALDDPNKKQHLVSFAWNCVRWIQENLLDENHIVCDGLSLKDGKWVLDKARFTYNTGTTMTAMSLLMGLGEFTKGLQDIEKLPTYLEDMARGALDTNGPLYDQSCNGSFKVWSDNTFFAQHLSEGLMTFSYAMPSSALAKPAQKMVLDQADFLMKYLRIPKEGLYYRNFGLYKLSPELTASFNKFFNANKQFQPDKDERIQQEGPVEQRPLCPTLIGSAGAARMLFSAAEIVNRNNPSSGESTTLPQPSHGKKDKDCVIS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
135	Phosphorylation	HYVSRAESIISLIIN CHHHHHHHHHHHHHH	25.00	25720772
361	Phosphorylation	YKLSPELTASFNKFF EECCHHHHHHHHHHH	20.70	28889911
363	Phosphorylation	LSPELTASFNKFFNA CCHHHHHHHHHHHCC	24.90	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MU191_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MU191_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MU191_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MU191_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MU191_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-361, AND MASSSPECTROMETRY.	18257517 [Abstract]