MU118_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MU118_SCHPO
• UniProt AC: O94328
• Protein Name: Meiotically up-regulated gene 118 protein
• Gene Name: mug118
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 141
• Subcellular Localization: Nucleus .
• Protein Description: Has a role in meiosis..
• Protein Sequence: MMNKRKRVEELGETKHRQVRQRILQEHKNDILENLAFELSDKVRRLRSNASLLASTIRMRGEMRIAAIPRAQRNMHLRDLKNHLSCNVSATPWRTKIKEFYNLDELSSQKSARQPTKTVASSSSSSSKSTTVSKSSSKSQV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
89	Phosphorylation	NHLSCNVSATPWRTK HHHCCCCCCCCHHHH	16.66	21712547
91	Phosphorylation	LSCNVSATPWRTKIK HCCCCCCCCHHHHHH	18.84	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MU118_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MU118_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MU118_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of MU118_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.