UniProt ID | MTPN_MOUSE | |
---|---|---|
UniProt AC | P62774 | |
Protein Name | Myotrophin | |
Gene Name | Mtpn | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 118 | |
Subcellular Localization | Cytoplasm . Nucleus. Cytoplasm, perinuclear region. | |
Protein Description | Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy (By similarity). Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer.. | |
Protein Sequence | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MCDKEFMWA ------CCCHHHHHH | 11.71 | 23806337 | |
4 | Acetylation | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 23806337 | |
4 | Ubiquitination | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 22790023 | |
11 | Acetylation | KEFMWALKNGDLDEV HHHHHHHHCCCHHHH | 51.65 | 23236377 | |
19 | Acetylation | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | 23236377 | |
24 | Acetylation | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 21728379 | |
24 | Ubiquitination | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 27667366 | |
31 | Phosphorylation | KGEDVNRTLEGGRKP CCCCCCCHHCCCCCC | 24.77 | 26824392 | |
41 | Phosphorylation | GGRKPLHYAADCGQL CCCCCCEEECCCCHH | 15.92 | 26060331 | |
82 | Phosphorylation | AVYEGHVSCVKLLLS HHHHCCHHHHHHHHH | 13.91 | - | |
97 | Ubiquitination | KGADKTVKGPDGLTA CCCCCCEECCCCCCH | 70.70 | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTPN_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTPN_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTPN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MTPN_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...