| UniProt ID | MTPN_MOUSE | |
|---|---|---|
| UniProt AC | P62774 | |
| Protein Name | Myotrophin | |
| Gene Name | Mtpn | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 118 | |
| Subcellular Localization | Cytoplasm . Nucleus. Cytoplasm, perinuclear region. | |
| Protein Description | Promotes dimerization of NF-kappa-B subunits and regulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy (By similarity). Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex formed by the CAPZA1 and CAPZB heterodimer.. | |
| Protein Sequence | MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MCDKEFMWA ------CCCHHHHHH | 11.71 | 23806337 | |
| 4 | Acetylation | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 23806337 | |
| 4 | Ubiquitination | ----MCDKEFMWALK ----CCCHHHHHHHH | 48.18 | 22790023 | |
| 11 | Acetylation | KEFMWALKNGDLDEV HHHHHHHHCCCHHHH | 51.65 | 23236377 | |
| 19 | Acetylation | NGDLDEVKDYVAKGE CCCHHHHHHHHHCCC | 41.09 | 23236377 | |
| 24 | Acetylation | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 21728379 | |
| 24 | Ubiquitination | EVKDYVAKGEDVNRT HHHHHHHCCCCCCCH | 53.43 | 27667366 | |
| 31 | Phosphorylation | KGEDVNRTLEGGRKP CCCCCCCHHCCCCCC | 24.77 | 26824392 | |
| 41 | Phosphorylation | GGRKPLHYAADCGQL CCCCCCEEECCCCHH | 15.92 | 26060331 | |
| 82 | Phosphorylation | AVYEGHVSCVKLLLS HHHHCCHHHHHHHHH | 13.91 | - | |
| 97 | Ubiquitination | KGADKTVKGPDGLTA CCCCCCEECCCCCCH | 70.70 | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTPN_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTPN_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTPN_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MTPN_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...