dbPTM

MTND3_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTND3_ARATH
UniProt AC	Q8W108
Protein Name	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 {ECO:0000255\|HAMAP-Rule:MF_03154}
Gene Name	ARD3
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	199
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene)..
Protein Sequence	MGEVVKDGREEVIQAWYMDDSEEDQRLPHHKDPKEFLSLDKLAELGVLSWRLDADNYETDEDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGSGYFDVRDRNEAWIRVWVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARKEYIDNFVKVNEGGVIDASA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
57	Phosphorylation	WRLDADNYETDEDLK EEECCCCCCCHHHHH	22.28	23776212
59	Phosphorylation	LDADNYETDEDLKKI ECCCCCCCHHHHHHH	34.04	23776212
147	Phosphorylation	AGIYHRFTVDSDNYI CCEEEEEEECCCCEE	24.30	28295753
150	Phosphorylation	YHRFTVDSDNYIKAM EEEEEECCCCEEEEE	24.34	28295753
153	Phosphorylation	FTVDSDNYIKAMRLF EEECCCCEEEEEEEC	14.59	28295753
198	Phosphorylation	EGGVIDASA------ CCCEEECCC------	30.66	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTND3_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTND3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTND3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
3HIDH_ARATH	AT4G20930	physical	21952135

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTND3_ARATH

Related Literatures of Post-Translational Modification