dbPTM

MTND1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTND1_ARATH
UniProt AC	O48707
Protein Name	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 1 {ECO:0000255\|HAMAP-Rule:MF_03154}
Gene Name	ARD1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	199
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene)..
Protein Sequence	MGEAAKDQTEEVIQAWYLDNKEEDQKLPHHKDPKEFVSLDKLAELGVLCWRLDADNYETDEELKRIRESRGYSYMDLCEVCPEKLPNYEEKVKMFFEEHLHIDEEIRYCLAGSGYFDVRDLNDIWIRVWVKKGGLIVFPAGIYHRFTVDSDNYMKAMRLFVGGPVWTAYNRPHDHLPARKAYMKKFLKVIGDRNIDASA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
59	Phosphorylation	LDADNYETDEELKRI ECCCCCCCHHHHHHH	38.05	26658240

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTND1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTND1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTND1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
EF1D1_ARATH	AT1G30230	physical	21952135

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTND1_ARATH

Related Literatures of Post-Translational Modification