dbPTM

MTHFS_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTHFS_MOUSE
UniProt AC	Q9D110
Protein Name	5-formyltetrahydrofolate cyclo-ligase
Gene Name	Mthfs
Organism	Mus musculus (Mouse).
Sequence Length	203
Subcellular Localization	Cytoplasm.
Protein Description	Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-CHO-H(4)PteGlu) to yield 5,10-methenyltetrahydrofolate (By similarity)..
Protein Sequence	MAAVTVNSAKRGLRAELKQRLRALSAEERLRQSLLLTQKVIAHNQYQNSKRISIFLSMQDEVETEVIIKDIFKQGKICFIPRYQFQSNHMDMVRLTSSEEIALLPKTSWNIHQPGEGDVREEALSTGGLDLIFLPGLGFDKDGNRLGRGKGYYDTYLKRCVQHQEVKPYTMALAFKEQICPQIPVDEHDMKVDEVLYEDSPAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAVTVNSA ------CCCEEHHHH	15.61	-
8	Phosphorylation	MAAVTVNSAKRGLRA CCCEEHHHHHHHHHH	30.72	30352176
50	Acetylation	HNQYQNSKRISIFLS CCCCCCCCEEEEEEE	62.39	2391867
64	Phosphorylation	SMQDEVETEVIIKDI ECCCCCEEEEHHHHH	40.50	24759943
83	Phosphorylation	KICFIPRYQFQSNHM CEEEEECCCCCCCCC	14.34	25367039
141	Acetylation	LPGLGFDKDGNRLGR CCCCCCCCCCCCCCC	66.33	23954790
150	Acetylation	GNRLGRGKGYYDTYL CCCCCCCCCHHHHHH	42.24	23806337
150	Succinylation	GNRLGRGKGYYDTYL CCCCCCCCCHHHHHH	42.24	23806337
158	Acetylation	GYYDTYLKRCVQHQE CHHHHHHHHHHHCCC	33.08	23864654
158	Succinylation	GYYDTYLKRCVQHQE CHHHHHHHHHHHCCC	33.08	23954790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTHFS_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTHFS_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTHFS_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MTHFS_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTHFS_MOUSE

Related Literatures of Post-Translational Modification