dbPTM

MTC1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MTC1_SCHPO
UniProt AC	O94548
Protein Name	Maintenance of telomere capping protein 1
Gene Name	SPCC1322.09
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	455
Subcellular Localization	Cytoplasm .
Protein Description	Involved in telomere capping..
Protein Sequence	MAETKEQTDDVETLMASLDQLGMEADPTSKEFNNDDSKIGAPSEVQDEKELLEFLDQLENDEEKNEKNPIEEANEENESVAATSNERQQHDASNQPSQAAQTTINKNTESATPKTVNEINKSQEFQEHVETPKQSNWLGGFWSTASAAVRSAEQRVRSIKGFEENANWDINVRNMVDLNKLGDLSNGIRSKALPTLSNTIHNVLNVVAPPIHDHEVLQVTVFHDLAGFAHLDRIVYESFEKVMFQVEGGELTVLLDKEAKVRPRTNDVYEDFGLCNGYLEAKKLAKANLAEPITEAKKMNKENKQENVGAGDDEDASESPMVRVTHLLLVIQAFTIKNKEVSDDEQLCFLIHLNDTNHNLEFSTTSQPLPLEWQRWAVDPRYIKLFGSNAILPNEWVTEWVEQSISVAAGIVAQMYTSKRMALGDPSLFAGLPEEDVNTGSSETPVPYYDGAMYA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MAETKEQTDDVETLM CCCCHHHCCHHHHHH	34.95	21712547
17	Phosphorylation	DVETLMASLDQLGME HHHHHHHHHHHHCCC	20.65	21712547
28	Phosphorylation	LGMEADPTSKEFNND HCCCCCCCCCCCCCC	53.64	21712547
43	Phosphorylation	DSKIGAPSEVQDEKE CCCCCCCHHHCCHHH	50.28	21712547
79	Phosphorylation	EANEENESVAATSNE HHHHHHCCHHCCCCH	28.74	21712547
115	Phosphorylation	TESATPKTVNEINKS CCCCCCCHHHHHHHC	29.75	29996109
122	Phosphorylation	TVNEINKSQEFQEHV HHHHHHHCHHHHHHC	30.38	28889911
131	Phosphorylation	EFQEHVETPKQSNWL HHHHHCCCCCCCCCC	34.40	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MTC1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MTC1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MTC1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MTC1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MTC1_SCHPO

Related Literatures of Post-Translational Modification