MT3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MT3_HUMAN
• UniProt AC: P25713
• Protein Name: Metallothionein-3
• Gene Name: MT3
• Organism: Homo sapiens (Human).
• Sequence Length: 68
• Protein Description: Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro..
• Protein Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPETCPC -------CCCCCCCC	20.49	1873033
5	Phosphorylation	---MDPETCPCPSGG ---CCCCCCCCCCCC	27.43	30576142
19	Phosphorylation	GSCTCADSCKCEGCK CCEECCCCCCCCCCC	9.28	30576142
33	Phosphorylation	KCTSCKKSCCSCCPA CCCCCCCCCCCCCHH	13.07	28985074

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MT3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MT3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MT3_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MT3_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.