UniProt ID | MT1X_HUMAN | |
---|---|---|
UniProt AC | P80297 | |
Protein Name | Metallothionein-1X | |
Gene Name | MT1X | |
Organism | Homo sapiens (Human). | |
Sequence Length | 61 | |
Subcellular Localization | ||
Protein Description | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling. [PubMed: 23251525] | |
Protein Sequence | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCCA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDPNCSCS -------CCCCCCCC | 20.42 | 19413330 | |
6 | Phosphorylation | --MDPNCSCSPVGSC --CCCCCCCCCCCCC | 25.03 | 23927012 | |
8 | Phosphorylation | MDPNCSCSPVGSCAC CCCCCCCCCCCCCCC | 13.31 | 23927012 | |
12 | Phosphorylation | CSCSPVGSCACAGSC CCCCCCCCCCCCCCC | 9.97 | 28258704 | |
18 | Phosphorylation | GSCACAGSCKCKECK CCCCCCCCCCCCCCC | 7.59 | 28258704 | |
32 | Phosphorylation | KCTSCKKSCCSCCPV CCCCCCCCCCCCCCC | 13.07 | 22777824 | |
35 | Phosphorylation | SCKKSCCSCCPVGCA CCCCCCCCCCCCCCC | 24.07 | 28258704 | |
43 | Ubiquitination | CCPVGCAKCAQGCIC CCCCCCCHHHCCCEE | 33.89 | - | |
51 | Ubiquitination | CAQGCICKGTSDKCS HHCCCEEECCCCCCC | 45.36 | - | |
51 | Acetylation | CAQGCICKGTSDKCS HHCCCEEECCCCCCC | 45.36 | 25953088 | |
53 | Phosphorylation | QGCICKGTSDKCSCC CCCEEECCCCCCCCC | 21.17 | 24719451 | |
58 | Phosphorylation | KGTSDKCSCCA---- ECCCCCCCCCC---- | 20.26 | 22798277 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MT1X_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MT1X_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MT1X_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MT1X_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-8, AND MASS SPECTROMETRY. | |
"Induction by zinc of specific metallothionein isoforms in humanmonocytes."; Pauwels M., van Weyenbergh J., Soumillion A., Proost P., Ley M.; Eur. J. Biochem. 220:105-110(1994). Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-31. | |
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGESCALE ANALYSIS] AT SER-8, AND MASS SPECTROMETRY. |