MT1E_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MT1E_HUMAN
• UniProt AC: P04732
• Protein Name: Metallothionein-1E
• Gene Name: MT1E
• Organism: Homo sapiens (Human).
• Sequence Length: 61
• Protein Description: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids..
• Protein Sequence: MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCCA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDPNCSCA -------CCCCCCCC	20.42	1779803
6	Phosphorylation	--MDPNCSCATGGSC --CCCCCCCCCCCCC	17.27	27134283
9	Phosphorylation	DPNCSCATGGSCTCA CCCCCCCCCCCCCCC	46.53	27134283
20	Ubiquitination	CTCAGSCKCKECKCT CCCCCCCCCCCCCCC	50.46	23503661
22	Ubiquitination	CAGSCKCKECKCTSC CCCCCCCCCCCCCCC	52.20	23503661
25	Ubiquitination	SCKCKECKCTSCKKS CCCCCCCCCCCCCCC	41.46	27667366
30	Ubiquitination	ECKCTSCKKSCCSCC CCCCCCCCCCCCCCC	47.70	23503661
31	Ubiquitination	CKCTSCKKSCCSCCP CCCCCCCCCCCCCCC	53.72	23503661
32	Phosphorylation	KCTSCKKSCCSCCPV CCCCCCCCCCCCCCC	13.07	22777824
32 (in isoform 2)	Phosphorylation	-	13.07	25690035
35	Phosphorylation	SCKKSCCSCCPVGCA CCCCCCCCCCCCCCC	24.07	28258704
43	Ubiquitination	CCPVGCAKCAQGCVC CCCCCCCHHHCCCEE	33.89	23503661
51	Ubiquitination	CAQGCVCKGASEKCS HHCCCEECCCCCCCC	36.79	23000965
56	Ubiquitination	VCKGASEKCSCCA-- EECCCCCCCCCCC--	29.02	23000965
58	Phosphorylation	KGASEKCSCCA---- CCCCCCCCCCC----	24.25	25072903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MT1E_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MT1E_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MT1E_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MT1E_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Amino acid sequence determination.";
Hunziker P.E.;
Methods Enzymol. 205:421-426(1991).
Cited for: PROTEIN SEQUENCE (ISOFORM 1), AND ACETYLATION AT MET-1.
PubMed: 1779803