| UniProt ID | MSTO1_MOUSE | |
|---|---|---|
| UniProt AC | Q2YDW2 | |
| Protein Name | Protein misato homolog 1 | |
| Gene Name | Msto1 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 556 | |
| Subcellular Localization | Mitochondrion outer membrane . Cytoplasm . | |
| Protein Description | Involved in the regulation of mitochondrial distribution and morphology. Required for mitochondrial fusion and mitochondrial network formation.. | |
| Protein Sequence | MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTHREDAHPKNPNLQGLLSAEGVRSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSICVIHKYHHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHDGFSGVGAKTAELLQDEYAGRGVLTWGLLPGPYSLGEPQKNIYRLLNTAFGLVHLTGYSSFVCPLSLGGNLGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLRSSMVTMAHLADVLSFSGKKVVTAEAIIPFPLVRGQSLPDILTQLGEATPWTSLSACGDSAGHRCFAQSVVLRGIDRASHTSKLNPGTPLPSALHACASGEEVLAQYLQQQHPRVLSSSHLLLTPCKVAPPYPHFFSSFSQKGLAMDSTPKGAAVQSIPVFGALRSTSSLHRTLGDLAEELSRLDLRRWASFMDAGVEQDDMEEMLHELHRLAQCYQEGDSLSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | Phosphorylation | RMAEDEESPGELCPD HHCCCCCCCCCCCCH | 35.84 | 16141072 | |
| 120 | Phosphorylation | PNLQGLLSAEGVRSS CCHHHHHCCCCCCCC | 29.35 | 29514104 | |
| 134 | Ubiquitination | SDGAWRAKLIQNIQN CCCHHHHHHHHHHHC | 37.23 | - | |
| 246 | Phosphorylation | YAGRGVLTWGLLPGP HCCCCCEEECCCCCC | 18.32 | - | |
| 254 | Phosphorylation | WGLLPGPYSLGEPQK ECCCCCCCCCCCCCH | 23.57 | - | |
| 369 | Phosphorylation | FPLVRGQSLPDILTQ CCCCCCCCHHHHHHH | 44.70 | 25293948 | |
| 375 | Phosphorylation | QSLPDILTQLGEATP CCHHHHHHHHCCCCC | 23.29 | 25293948 | |
| 456 | Phosphorylation | SSSHLLLTPCKVAPP CCCCEEEECCCCCCC | 26.98 | 26745281 | |
| 474 | Ubiquitination | FFSSFSQKGLAMDST CCCCCCCCCCCCCCC | 55.48 | - | |
| 483 | Ubiquitination | LAMDSTPKGAAVQSI CCCCCCCCCCCCCCC | 62.36 | - | |
| 499 | Phosphorylation | VFGALRSTSSLHRTL CCCHHHCHHHHHHHH | 18.85 | 28059163 | |
| 553 | Phosphorylation | QCYQEGDSLSN---- HHHHHCCCCCC---- | 44.55 | 28066266 | |
| 555 | Phosphorylation | YQEGDSLSN------ HHHCCCCCC------ | 44.43 | 26643407 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSTO1_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSTO1_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSTO1_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MSTO1_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
