UniProt ID | MSTN1_HUMAN | |
---|---|---|
UniProt AC | Q8IVN3 | |
Protein Name | Musculoskeletal embryonic nuclear protein 1 | |
Gene Name | MUSTN1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 82 | |
Subcellular Localization | Nucleus. | |
Protein Description | May be involved in the development and regeneration of the musculoskeletal system.. | |
Protein Sequence | MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSQAGAQEA ------CCCCCCCCC | 28.83 | 22673903 | |
52 | Phosphorylation | RECEQAGSAAPSVFS HHHHHHCCCCCCCCC | 25.03 | 23532336 | |
56 | Phosphorylation | QAGSAAPSVFSRTRT HHCCCCCCCCCCCCC | 30.94 | 29449344 | |
59 | Phosphorylation | SAAPSVFSRTRTGTE CCCCCCCCCCCCCCE | 30.50 | 29449344 | |
61 | Phosphorylation | APSVFSRTRTGTETV CCCCCCCCCCCCEEC | 31.24 | 26437602 | |
63 | Phosphorylation | SVFSRTRTGTETVFE CCCCCCCCCCEECCC | 48.09 | 26437602 | |
65 | Phosphorylation | FSRTRTGTETVFEKP CCCCCCCCEECCCCC | 28.06 | 26437602 | |
67 | Phosphorylation | RTRTGTETVFEKPKA CCCCCCEECCCCCCC | 30.27 | 29449344 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSTN1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSTN1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSTN1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MSTN1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...