MSTN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MSTN1_HUMAN
• UniProt AC: Q8IVN3
• Protein Name: Musculoskeletal embryonic nuclear protein 1
• Gene Name: MUSTN1
• Organism: Homo sapiens (Human).
• Sequence Length: 82
• Subcellular Localization: Nucleus.
• Protein Description: May be involved in the development and regeneration of the musculoskeletal system..
• Protein Sequence: MSQAGAQEAPIKKKRPPVKDEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSQAGAQEA ------CCCCCCCCC	28.83	22673903
52	Phosphorylation	RECEQAGSAAPSVFS HHHHHHCCCCCCCCC	25.03	23532336
56	Phosphorylation	QAGSAAPSVFSRTRT HHCCCCCCCCCCCCC	30.94	29449344
59	Phosphorylation	SAAPSVFSRTRTGTE CCCCCCCCCCCCCCE	30.50	29449344
61	Phosphorylation	APSVFSRTRTGTETV CCCCCCCCCCCCEEC	31.24	26437602
63	Phosphorylation	SVFSRTRTGTETVFE CCCCCCCCCCEECCC	48.09	26437602
65	Phosphorylation	FSRTRTGTETVFEKP CCCCCCCCEECCCCC	28.06	26437602
67	Phosphorylation	RTRTGTETVFEKPKA CCCCCCEECCCCCCC	30.27	29449344

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MSTN1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MSTN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MSTN1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MSTN1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.