| UniProt ID | MSRA_HUMAN | |
|---|---|---|
| UniProt AC | Q9UJ68 | |
| Protein Name | Mitochondrial peptide methionine sulfoxide reductase | |
| Gene Name | MSRA | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 235 | |
| Subcellular Localization |
Isoform 1: Mitochondrion. Isoform 2: Cytoplasm. Isoform 3: Cytoplasm. Nucleus. Isoform 5: Cytoplasm. Membrane Lipid-anchor . |
|
| Protein Description | Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.. | |
| Protein Sequence | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 (in isoform 5) | Myristoylation | - | 4.85 | 25807930 | |
| 40 | Ubiquitination | PQEALPGRKEQTPVA HHHHCCCCCCCCCCC | 37.08 | 29967540 | |
| 41 | Methylation | QEALPGRKEQTPVAA HHHCCCCCCCCCCCE | 61.15 | - | |
| 46 | Ubiquitination | GRKEQTPVAAKHHVN CCCCCCCCCEECCCC | 10.32 | 29967540 | |
| 49 | Methylation | EQTPVAAKHHVNGNR CCCCCCEECCCCCCC | 25.22 | - | |
| 63 | Ubiquitination | RTVEPFPEGTQMAVF CCCCCCCCCCEEEEE | 75.22 | 29967540 | |
| 69 | Ubiquitination | PEGTQMAVFGMGCFW CCCCEEEEEEECCCC | 3.41 | 29967540 | |
| 75 | Ubiquitination | AVFGMGCFWGAERKF EEEEECCCCCHHHHH | 5.81 | 22817900 | |
| 80 | Ubiquitination | GCFWGAERKFWVLKG CCCCCHHHHHHEEEE | 38.65 | 21890473 | |
| 101 | Ubiquitination | GFAGGYTSNPTYKEV EECCCCCCCCCHHHH | 32.12 | 29967540 | |
| 106 | Succinylation | YTSNPTYKEVCSEKT CCCCCCHHHHHCCCC | 46.26 | - | |
| 106 | Acetylation | YTSNPTYKEVCSEKT CCCCCCHHHHHCCCC | 46.26 | 25038526 | |
| 106 | Ubiquitination | YTSNPTYKEVCSEKT CCCCCCHHHHHCCCC | 46.26 | 29967540 | |
| 106 | Succinylation | YTSNPTYKEVCSEKT CCCCCCHHHHHCCCC | 46.26 | - | |
| 110 | Ubiquitination | PTYKEVCSEKTGHAE CCHHHHHCCCCCCEE | 47.50 | 22817900 | |
| 112 | Ubiquitination | YKEVCSEKTGHAEVV HHHHHCCCCCCEEEE | 43.44 | 29967540 | |
| 115 | Ubiquitination | VCSEKTGHAEVVRVV HHCCCCCCEEEEEEE | 24.77 | 21890473 | |
| 124 | Ubiquitination | EVVRVVYQPEHMSFE EEEEEEECCCCCCHH | 25.87 | 29967540 | |
| 127 | Ubiquitination | RVVYQPEHMSFEELL EEEECCCCCCHHHHH | 24.70 | 29967540 | |
| 133 | Ubiquitination | EHMSFEELLKVFWEN CCCCHHHHHHHHHHC | 4.40 | 22817900 | |
| 135 | Acetylation | MSFEELLKVFWENHD CCHHHHHHHHHHCCC | 48.27 | 25038526 | |
| 136 | Ubiquitination | SFEELLKVFWENHDP CHHHHHHHHHHCCCC | 7.32 | 22817900 | |
| 138 | Ubiquitination | EELLKVFWENHDPTQ HHHHHHHHHCCCCCC | 14.41 | 21890473 | |
| 138 | Ubiquitination | EELLKVFWENHDPTQ HHHHHHHHHCCCCCC | 14.41 | 21890473 | |
| 138 | Ubiquitination | EELLKVFWENHDPTQ HHHHHHHHHCCCCCC | 14.41 | 21890473 | |
| 141 | Ubiquitination | LKVFWENHDPTQGMR HHHHHHCCCCCCCCC | 30.80 | 21890473 | |
| 146 | Ubiquitination | ENHDPTQGMRQGNDH HCCCCCCCCCCCCCC | 18.73 | 21890473 | |
| 157 | Phosphorylation | GNDHGTQYRSAIYPT CCCCCHHHCCCCCCC | 13.33 | 22210691 | |
| 167 | Ubiquitination | AIYPTSAKQMEAALS CCCCCCHHHHHHHHH | 50.36 | 29967540 | |
| 174 | Phosphorylation | KQMEAALSSKENYQK HHHHHHHHCHHHHHH | 34.34 | 26853621 | |
| 175 | Phosphorylation | QMEAALSSKENYQKV HHHHHHHCHHHHHHH | 44.85 | 26853621 | |
| 176 | Ubiquitination | MEAALSSKENYQKVL HHHHHHCHHHHHHHH | 46.75 | 22817900 | |
| 181 | Ubiquitination | SSKENYQKVLSEHGF HCHHHHHHHHHHHCC | 34.48 | 22817900 | |
| 181 | Ubiquitination | SSKENYQKVLSEHGF HCHHHHHHHHHHHCC | 34.48 | 21890473 | |
| 184 | Phosphorylation | ENYQKVLSEHGFGPI HHHHHHHHHHCCCCE | 30.45 | 25693802 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MSRA_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MSRA_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MSRA_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CH10_HUMAN | HSPE1 | physical | 26344197 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00134 | L-Methionine |
loading...