MS57A_DROME - dbPTM
MS57A_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID MS57A_DROME
UniProt AC Q9VBL6
Protein Name Accessory gland-specific peptide 57Da
Gene Name Mst57Da
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 75
Subcellular Localization Secreted .
Protein Description Transferred from male to female during mating and may affect egglaying and behavior after mating..
Protein Sequence MKFLALFVTLLVVLALVSAQKSQNTNHNVIVIGAKKPGAAPAAAAAAAPAAPPAAAPAAAPAAPEAGLADAPAES
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of MS57A_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of MS57A_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of MS57A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of MS57A_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of MS57A_DROME !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of MS57A_DROME

loading...

Related Literatures of Post-Translational Modification

TOP