UniProt ID | MRT4_SCHPO | |
---|---|---|
UniProt AC | Q9USZ6 | |
Protein Name | Ribosome assembly factor mrt4 {ECO:0000250|UniProtKB:P33201} | |
Gene Name | mrt4 {ECO:0000250|UniProtKB:P33201} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 241 | |
Subcellular Localization | Nucleus, nucleolus . Cytoplasm . Shuttles between the nucleus and the cytoplasm. | |
Protein Description | Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes.. | |
Protein Sequence | MPKSRRSKVLTLAQTEKKGHEGKAALFSGVQQSLDSFDYMWIFDVTNMRNTYLKRIRDDWKGSRIFMGKTKVMAKALGHTPEEEHAENVSKLTKLLHGAVGLLFTNSKPDEVIGYFESFVQNDFARAGAVAPFTHVIPAGPVYSRAGQIPVEDDILLTHTLEPQVRQLGMPTVLKNGVVTLLADFPLCTEGQQLDSRQTRLLKLFGITAAEFKVGLLGYYSKKGASVEFLQSAPGADEAME | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of MRT4_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRT4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRT4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRT4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MRT4_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...