MRT4_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MRT4_MOUSE
• UniProt AC: Q9D0I8
• Protein Name: mRNA turnover protein 4 homolog {ECO:0000250|UniProtKB:P33201}
• Gene Name: Mrto4
• Organism: Mus musculus (Mouse).
• Sequence Length: 239
• Subcellular Localization: Nucleus, nucleolus . Cytoplasm . Shuttles between the nucleus and the cytoplasm.
• Protein Description: Component of the ribosome assembly machinery. Nuclear paralog of the ribosomal protein P0, it binds pre-60S subunits at an early stage of assembly in the nucleolus, and is replaced by P0 in cytoplasmic pre-60S subunits and mature 80S ribosomes..
• Protein Sequence: MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKKLRGEVGLLFTNRTKEEVNEWFTKYTEMDFARAGNKATLTVSLDPGPLKQFPHSMEPQLRQLGLPTALKKGVVTLLSDYEVCKEGDVLTPEQARILKLFGYEMAEFKVIIKYMWDAQSGRFQQMDDDLPESAPESEGESEEEDDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
51	Phosphorylation	SVANMRNSKLKDIRN HHHHCCCCCHHHHHH	29.06	-
80	Phosphorylation	MMVALGRSPSDEYKD EEEECCCCCCHHHHH	27.27	26643407
82	Phosphorylation	VALGRSPSDEYKDNL EECCCCCCHHHHHHH	44.30	28066266
85	Phosphorylation	GRSPSDEYKDNLHQV CCCCCHHHHHHHHHH	28.74	26643407
225	Phosphorylation	MDDDLPESAPESEGE CCCCCCCCCCCCCCC	47.38	21082442
229	Phosphorylation	LPESAPESEGESEEE CCCCCCCCCCCCCCC	50.25	21082442
233	Phosphorylation	APESEGESEEEDDS- CCCCCCCCCCCCCC-	62.25	21082442
239	Phosphorylation	ESEEEDDS------- CCCCCCCC-------	55.21	21149613

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MRT4_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MRT4_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MRT4_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of MRT4_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.