UniProt ID | MRM3_DROME | |
---|---|---|
UniProt AC | Q9VW14 | |
Protein Name | rRNA methyltransferase 3, mitochondrial {ECO:0000250|UniProtKB:Q9HC36} | |
Gene Name | CG14100 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 407 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methylguanosine at position 1580 (Gm1580) in the mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a conserved modification in the peptidyl transferase domain of the mtLSU rRNA.. | |
Protein Sequence | MLCNIFKRSLQANIRNVNNLNVLRLSSSSGPRGEIQDALDIEANLFGNSDLRHEPMNTREALRKNRFAGRKPKVPFASVASRNLSAPSNPAPRVAPTPAPVIKDNELNLEFVRLTLQDPLTSTLLTTVRSRKRRDKNRQIIVEGRRLIQEALQCGLKMEVLLFSQKDQLALVKEEVGVAQVETGTKIYKVPQHDLKTWSSLVTPPGLMAIFDRPSDKGLEKNLAEQQRLGSQPFPITVVCDNIREPNNLGSIIRTCAALPCSQVVVTHGCCDPWESKALRGGCGGQFRVPIRDDVTWDELALTIPPEAADDCHVFIAETNQRKRENNQTIDYADIKGLGAHNLLIIGGESHGVSEEAYRFLNLVGGKGKCIYIPLAAGIDSLNVASALTLLLFELRRKLIHQASEKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
78 | Phosphorylation | KPKVPFASVASRNLS CCCCCHHHHHCCCCC | 22817900 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRM3_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRM3_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRM3_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MRM3_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...