| UniProt ID | MRM2_HUMAN | |
|---|---|---|
| UniProt AC | Q9UI43 | |
| Protein Name | rRNA methyltransferase 2, mitochondrial {ECO:0000303|PubMed:24036117} | |
| Gene Name | MRM2 {ECO:0000303|PubMed:24036117} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 246 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | S-adenosyl-L-methionine-dependent 2'-O-ribose methyltransferase that catalyzes the formation of 2'-O-methyluridine at position 1369 (Um1369) in the 16S mitochondrial large subunit ribosomal RNA (mtLSU rRNA), a universally conserved modification in the peptidyl transferase domain of the mtLSU rRNA.. | |
| Protein Sequence | MAGYLKLVCVSFQRQGFHTVGSRCKNRTGAEHLWLTRHLRDPFVKAAKVESYRCRSAFKLLEVNERHQILRPGLRVLDCGAAPGAWSQVAVQKVNAAGTDPSSPVGFVLGVDLLHIFPLEGATFLCPADVTDPRTSQRILEVLPGRRADVILSDMAPNATGFRDLDHDRLISLCLTLLSVTPDILQPGGTFLCKTWAGSQSRRLQRRLTEEFQNVRIIKPEASRKESSEVYFLATQYHGRKGTVKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Ubiquitination | HLRDPFVKAAKVESY HHCCCHHHHHHCCCH | 21890473 | ||
| 45 | Ubiquitination | HLRDPFVKAAKVESY HHCCCHHHHHHCCCH | 21890473 | ||
| 48 | Ubiquitination | DPFVKAAKVESYRCR CCHHHHHHCCCHHCC | 21890473 | ||
| 48 | Ubiquitination | DPFVKAAKVESYRCR CCHHHHHHCCCHHCC | 21890473 | ||
| 51 | Phosphorylation | VKAAKVESYRCRSAF HHHHHCCCHHCCHHH | - | ||
| 56 | Phosphorylation | VESYRCRSAFKLLEV CCCHHCCHHHHHHHH | - | ||
| 59 | Ubiquitination | YRCRSAFKLLEVNER HHCCHHHHHHHHHHH | 21890473 | ||
| 59 | Ubiquitination | YRCRSAFKLLEVNER HHCCHHHHHHHHHHH | 21890473 | ||
| 176 | Phosphorylation | RLISLCLTLLSVTPD HHHHHHHHHHHCCCC | 24719451 | ||
| 181 | Phosphorylation | CLTLLSVTPDILQPG HHHHHHCCCCCCCCC | 24719451 | ||
| 209 | Phosphorylation | RRLQRRLTEEFQNVR HHHHHHHHHHHHCCE | 28450419 | ||
| 219 | Ubiquitination | FQNVRIIKPEASRKE HHCCEEECCCHHCCC | - | ||
| 225 | Ubiquitination | IKPEASRKESSEVYF ECCCHHCCCCCCEEE | 21890473 | ||
| 225 | Ubiquitination | IKPEASRKESSEVYF ECCCHHCCCCCCEEE | 21890473 | ||
| 227 | Phosphorylation | PEASRKESSEVYFLA CCHHCCCCCCEEEEE | 30108239 | ||
| 228 | Phosphorylation | EASRKESSEVYFLAT CHHCCCCCCEEEEEE | 30108239 | ||
| 231 | Phosphorylation | RKESSEVYFLATQYH CCCCCCEEEEEEEEC | 30108239 | ||
| 237 | Phosphorylation | VYFLATQYHGRKGTV EEEEEEEECCCCCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRM2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRM2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRM2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MRM2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
