| UniProt ID | MPIP3_MOUSE | |
|---|---|---|
| UniProt AC | P48967 | |
| Protein Name | M-phase inducer phosphatase 3 | |
| Gene Name | Cdc25c | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 447 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. Directly dephosphorylates CDK1 and activates its kinase activity. When phosphorylated, highly effective in activating G2 cells into prophase (By similarity). May be involved in regulating the proliferation of T-lymphocytes following cytokine stimulation.. | |
| Protein Sequence | MSTGPIPPASEEGSFVSAPSFRSKQRKILHLLLERNTSFTIRSDFPESPKDKLHDSANLSILSGGTPKCCLDLSNLSSGEMSASPLTTSADLEDNGSLDSSGPLDRQLTGKDFHQDLMKGIPVQLLCSTPNAMNHGHRKKIAKRSTSAHKENINTSLKALEWEAPRTPRFRKMPGGPLTSPLCELEMKHLGSPITTVPKLSQNVKLEDQERISEDPMECSLGDQDAKGLSLRKMVPLCDMNAIQMEEEESGSELLIGDFSKVCVLPTVPGKHPDLKYISPDTVAALLSGKFQSVIERFYIIDCRYPYEYLGGHILGALNLHSQKELHEFFLRKPVVPLDIQKRVIIVFLCEFSSERGPRMCRSLREKDRALNQYPALYYPELYILKGGYRDFFPEYMELCDPQSYCPMLHQDHQAELLSWRSQSKAQEGERQLQGQIALLVKGASPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSTGPIPPA ------CCCCCCCCC | 41.91 | - | |
| 2 | Phosphorylation | ------MSTGPIPPA ------CCCCCCCCC | 41.91 | 25168779 | |
| 3 | Phosphorylation | -----MSTGPIPPAS -----CCCCCCCCCC | 45.75 | 25168779 | |
| 10 | Phosphorylation | TGPIPPASEEGSFVS CCCCCCCCCCCCCCC | 41.79 | 25168779 | |
| 14 | Phosphorylation | PPASEEGSFVSAPSF CCCCCCCCCCCCCCH | 26.25 | 25168779 | |
| 17 | Phosphorylation | SEEGSFVSAPSFRSK CCCCCCCCCCCHHHH | 32.24 | 25168779 | |
| 20 | Phosphorylation | GSFVSAPSFRSKQRK CCCCCCCCHHHHHHH | 32.77 | - | |
| 37 | Phosphorylation | HLLLERNTSFTIRSD HHHHHCCCCEEECCC | 31.29 | 28066266 | |
| 38 | Phosphorylation | LLLERNTSFTIRSDF HHHHCCCCEEECCCC | 24.76 | 28066266 | |
| 40 | Phosphorylation | LERNTSFTIRSDFPE HHCCCCEEECCCCCC | 18.43 | 28066266 | |
| 48 | Phosphorylation | IRSDFPESPKDKLHD ECCCCCCCCCCCCCC | 37.17 | 25266776 | |
| 56 | Phosphorylation | PKDKLHDSANLSILS CCCCCCCCCCEEHHC | 14.33 | - | |
| 60 | Phosphorylation | LHDSANLSILSGGTP CCCCCCEEHHCCCCC | 22.69 | - | |
| 63 | Phosphorylation | SANLSILSGGTPKCC CCCEEHHCCCCCCEE | 33.24 | - | |
| 66 | Phosphorylation | LSILSGGTPKCCLDL EEHHCCCCCCEEEEC | 24.09 | - | |
| 128 | Phosphorylation | IPVQLLCSTPNAMNH CCCEEEECCCCCCCC | 47.04 | - | |
| 129 | Phosphorylation | PVQLLCSTPNAMNHG CCEEEECCCCCCCCC | 21.40 | - | |
| 143 | Ubiquitination | GHRKKIAKRSTSAHK CHHHHHHHHCCHHHH | 50.81 | - | |
| 150 | Ubiquitination | KRSTSAHKENINTSL HHCCHHHHHHHHHHH | 52.77 | - | |
| 156 | Phosphorylation | HKENINTSLKALEWE HHHHHHHHHHHHHCC | 24.31 | 27841257 | |
| 167 | Phosphorylation | LEWEAPRTPRFRKMP HHCCCCCCCCCCCCC | 20.11 | 29514104 | |
| 179 | Phosphorylation | KMPGGPLTSPLCELE CCCCCCCCCCHHHHH | 31.28 | 26643407 | |
| 180 | Phosphorylation | MPGGPLTSPLCELEM CCCCCCCCCHHHHHH | 24.45 | 26643407 | |
| 192 | Phosphorylation | LEMKHLGSPITTVPK HHHHHCCCCCCCCCH | 21.35 | 25266776 | |
| 195 | Phosphorylation | KHLGSPITTVPKLSQ HHCCCCCCCCCHHHC | 25.73 | 28066266 | |
| 196 | Phosphorylation | HLGSPITTVPKLSQN HCCCCCCCCCHHHCC | 35.21 | 26643407 | |
| 213 | Phosphorylation | LEDQERISEDPMECS CCCHHHHCCCCCCCC | 42.01 | - | |
| 220 | Phosphorylation | SEDPMECSLGDQDAK CCCCCCCCCCCCCCC | 23.29 | 28066266 | |
| 230 | Phosphorylation | DQDAKGLSLRKMVPL CCCCCCCCHHHHHHC | 34.49 | - | |
| 293 | Phosphorylation | LLSGKFQSVIERFYI HHCCCHHHHHHEEEE | 28.35 | 23737553 | |
| 445 | Phosphorylation | ALLVKGASPQ----- HHHHCCCCCC----- | 32.28 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 66 | T | Phosphorylation | Kinase | CDK1 | P11440 | Uniprot |
| 192 | S | Phosphorylation | Kinase | CDK1 | P11440 | Uniprot |
| 213 | S | Phosphorylation | Kinase | PLK3 | Q60806 | Uniprot |
| 220 | S | Phosphorylation | Kinase | PLK3 | Q60806 | Uniprot |
| Modified Location | Modified Residue | Modification | Function | Reference |
|---|---|---|---|---|
| 213 | S | Phosphorylation |
| - |
| 220 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPIP3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MPIP3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...