MPC1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPC1_HUMAN
• UniProt AC: Q9Y5U8
• Protein Name: Mitochondrial pyruvate carrier 1
• Gene Name: MPC1
• Organism: Homo sapiens (Human).
• Sequence Length: 109
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Mediates the uptake of pyruvate into mitochondria..
• Protein Sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAGALVRKA ------CCCHHHHHH	16.38	25944712
12	Phosphorylation	LVRKAADYVRSKDFR HHHHHHHHHHCHHHH	7.95	24719451
15	Phosphorylation	KAADYVRSKDFRDYL HHHHHHHCHHHHHHH	26.91	24719451
47	Phosphorylation	AINDMKKSPEIISGR HHCHHCCCHHHHCCH	23.42	23312004
72	Acetylation	TFMRFAYKVQPRNWL HHHHHHHCCCCCCEE	30.85	-
72	Malonylation	TFMRFAYKVQPRNWL HHHHHHHCCCCCCEE	30.85	26320211

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPC1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MPC1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPC1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MPC1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.