MP3B2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MP3B2_HUMAN
• UniProt AC: A6NCE7
• Protein Name: Microtubule-associated proteins 1A/1B light chain 3 beta 2
• Gene Name: MAP1LC3B2
• Organism: Homo sapiens (Human).
• Sequence Length: 125
• Subcellular Localization: Cytoplasm, cytoskeleton. Endomembrane system; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane; Lipid-anchor. LC3-II binds to the autophagic membranes..
• Protein Description: Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity)..
• Protein Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Ubiquitination	---MPSEKTFKQRRT ---CCCHHHHHHHHC	64.70	29967540
6	Phosphorylation	--MPSEKTFKQRRTF --CCCHHHHHHHHCH	31.82	20398630
8	Ubiquitination	MPSEKTFKQRRTFEQ CCCHHHHHHHHCHHH	48.39	24816145
21	Methylation	EQRVEDVRLIREQHP HHHHHHHHHHHHHCC	36.40	-
29	Phosphorylation	LIREQHPTKIPVIIE HHHHHCCCCCCEEEE	39.21	22817900
30	Malonylation	IREQHPTKIPVIIER HHHHCCCCCCEEEEE	49.84	26320211
30	Ubiquitination	IREQHPTKIPVIIER HHHHCCCCCCEEEEE	49.84	33845483
42	Ubiquitination	IERYKGEKQLPVLDK EEECCCCCCCCCCCC	66.84	32015554
49	Ubiquitination	KQLPVLDKTKFLVPD CCCCCCCCCCCCCCC	49.83	22817900
51	Ubiquitination	LPVLDKTKFLVPDHV CCCCCCCCCCCCCCC	42.30	22817900
65	Ubiquitination	VNMSELIKIIRRRLQ CCHHHHHHHHHHHHC	44.71	21890473
115	Ubiquitination	FLYMVCASQETFGMK CEEEEEECCCCCCEE	24.34	24816145
120	Phosphatidylethanolamine amidation	CASQETFGMKLSV-- EECCCCCCEECCC--	21.53	-
137	Ubiquitination	------------------- -------------------		24816145
149	Ubiquitination	------------------------------- -------------------------------		27667366
156	Ubiquitination	-------------------------------------- --------------------------------------		22817900
158	Ubiquitination	---------------------------------------- ----------------------------------------		21890473
172	Ubiquitination	------------------------------------------------------ ------------------------------------------------------		21890473

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MP3B2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MP3B2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MP3B2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MP3B2_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.