UniProt ID | MP3B2_HUMAN | |
---|---|---|
UniProt AC | A6NCE7 | |
Protein Name | Microtubule-associated proteins 1A/1B light chain 3 beta 2 | |
Gene Name | MAP1LC3B2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization |
Cytoplasm, cytoskeleton. Endomembrane system Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane Lipid-anchor. LC3-II binds to the autophagic membranes.. |
|
Protein Description | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation (By similarity).. | |
Protein Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Ubiquitination | ---MPSEKTFKQRRT ---CCCHHHHHHHHC | 64.70 | 29967540 | |
6 | Phosphorylation | --MPSEKTFKQRRTF --CCCHHHHHHHHCH | 31.82 | 20398630 | |
8 | Ubiquitination | MPSEKTFKQRRTFEQ CCCHHHHHHHHCHHH | 48.39 | 24816145 | |
21 | Methylation | EQRVEDVRLIREQHP HHHHHHHHHHHHHCC | 36.40 | - | |
29 | Phosphorylation | LIREQHPTKIPVIIE HHHHHCCCCCCEEEE | 39.21 | 22817900 | |
30 | Malonylation | IREQHPTKIPVIIER HHHHCCCCCCEEEEE | 49.84 | 26320211 | |
30 | Ubiquitination | IREQHPTKIPVIIER HHHHCCCCCCEEEEE | 49.84 | 33845483 | |
42 | Ubiquitination | IERYKGEKQLPVLDK EEECCCCCCCCCCCC | 66.84 | 32015554 | |
49 | Ubiquitination | KQLPVLDKTKFLVPD CCCCCCCCCCCCCCC | 49.83 | 22817900 | |
51 | Ubiquitination | LPVLDKTKFLVPDHV CCCCCCCCCCCCCCC | 42.30 | 22817900 | |
65 | Ubiquitination | VNMSELIKIIRRRLQ CCHHHHHHHHHHHHC | 44.71 | 21890473 | |
115 | Ubiquitination | FLYMVCASQETFGMK CEEEEEECCCCCCEE | 24.34 | 24816145 | |
120 | Phosphatidylethanolamine amidation | CASQETFGMKLSV-- EECCCCCCEECCC-- | 21.53 | - | |
137 | Ubiquitination | ------------------- ------------------- | 24816145 | ||
149 | Ubiquitination | ------------------------------- ------------------------------- | 27667366 | ||
156 | Ubiquitination | -------------------------------------- -------------------------------------- | 22817900 | ||
158 | Ubiquitination | ---------------------------------------- ---------------------------------------- | 21890473 | ||
172 | Ubiquitination | ------------------------------------------------------ ------------------------------------------------------ | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MP3B2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MP3B2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MP3B2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MP3B2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...