MP2K3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MP2K3_MOUSE
• UniProt AC: O09110
• Protein Name: Dual specificity mitogen-activated protein kinase kinase 3
• Gene Name: Map2k3
• Organism: Mus musculus (Mouse).
• Sequence Length: 347
• Protein Description: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14..
• Protein Sequence: MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVDFTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MESPAASP -------CCCCCCCC	11.82	-
3	Phosphorylation	-----MESPAASPPA -----CCCCCCCCCC	20.67	25619855
7	Phosphorylation	-MESPAASPPASLPQ -CCCCCCCCCCCCCC	33.26	25619855
11	Phosphorylation	PAASPPASLPQTKGK CCCCCCCCCCCCCCC	46.48	25619855
28	Phosphorylation	RKKDLRISCVSKPPV CCCCCEEEEECCCCC	11.30	22942356
29	S-nitrosocysteine	KKDLRISCVSKPPVS CCCCEEEEECCCCCC	3.59	-
29	Glutathionylation	KKDLRISCVSKPPVS CCCCEEEEECCCCCC	3.59	24333276
29	S-nitrosylation	KKDLRISCVSKPPVS CCCCEEEEECCCCCC	3.59	21278135
31	Phosphorylation	DLRISCVSKPPVSNP CCEEEEECCCCCCCC	43.71	22942356
39	Phosphorylation	KPPVSNPTPPRNLDS CCCCCCCCCCCCCCC	50.61	30482847
80	Ubiquitination	GAYGVVEKVRHAQSG CCHHHHHHHHHCCCC	32.72	22790023
200	Acetylation	PSNVLINKEGHVKMC HHHEEECCCCCEEEC	59.07	23954790
218	Phosphorylation	ISGYLVDSVAKTMDA CCCCHHHHHHHHCCC	19.25	22322096
222	Phosphorylation	LVDSVAKTMDAGCKP HHHHHHHHCCCCCCC	15.56	19060867
227	Glutathionylation	AKTMDAGCKPYMAPE HHHCCCCCCCCCCCC	4.26	24333276
243	Ubiquitination	INPELNQKGYNVKSD CCHHHHHCCCCCHHH	63.39	-
243	Malonylation	INPELNQKGYNVKSD CCHHHHHCCCCCHHH	63.39	26320211
305	Glutathionylation	FVDFTSQCLRKNPAE HHHHHHHHHHCCHHH	3.88	24333276

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MP2K3_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
218	S	Phosphorylation	Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity.	-
222	T	Phosphorylation	Phosphorylation on Ser-218 and Thr-222 by MAP kinase kinase kinases regulates positively the kinase activity.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MP2K3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MK14_MOUSE	Mapk14	physical	15644321

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.