UniProt ID | MOT8_HUMAN | |
---|---|---|
UniProt AC | P36021 | |
Protein Name | Monocarboxylate transporter 8 | |
Gene Name | SLC16A2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 539 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | Very active and specific thyroid hormone transporter. Stimulates cellular uptake of thyroxine (T4), triiodothyronine (T3), reverse triiodothyronine (rT3) and diidothyronine. Does not transport Leu, Phe, Trp or Tyr.. | |
Protein Sequence | MALQSQASEEAKGPWQEADQEQQEPVGSPEPESEPEPEPEPEPVPVPPPEPQPEPQPLPDPAPLPELEFESERVHEPEPTPTVETRGTARGFQPPEGGFGWVVVFAATWCNGSIFGIHNSVGILYSMLLEEEKEKNRQVEFQAAWVGALAMGMIFFCSPIVSIFTDRLGCRITATAGAAVAFIGLHTSSFTSSLSLRYFTYGILFGCGCSFAFQPSLVILGHYFQRRLGLANGVVSAGSSIFSMSFPFLIRMLGDKIKLAQTFQVLSTFMFVLMLLSLTYRPLLPSSQDTPSKRGVRTLHQRFLAQLRKYFNMRVFRQRTYRIWAFGIAAAALGYFVPYVHLMKYVEEEFSEIKETWVLLVCIGATSGLGRLVSGHISDSIPGLKKIYLQVLSFLLLGLMSMMIPLCRDFGGLIVVCLFLGLCDGFFITIMAPIAFELVGPMQASQAIGYLLGMMALPMIAGPPIAGLLRNCFGDYHVAFYFAGVPPIIGAVILFFVPLMHQRMFKKEQRDSSKDKMLAPDPDPNGELLPGSPNPEEPI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MALQSQASE ------CCCCCCCCH | 17.82 | 22223895 | |
5 | Phosphorylation | ---MALQSQASEEAK ---CCCCCCCCHHHC | 28.67 | 29514088 | |
8 | Phosphorylation | MALQSQASEEAKGPW CCCCCCCCHHHCCCH | 28.47 | 25849741 | |
71 | Phosphorylation | LPELEFESERVHEPE CCCCEECCCCCCCCC | 35.70 | 24275569 | |
80 | Phosphorylation | RVHEPEPTPTVETRG CCCCCCCCCCEEECC | 29.90 | 30266825 | |
82 | Phosphorylation | HEPEPTPTVETRGTA CCCCCCCCEEECCCC | 33.19 | 30266825 | |
85 | Phosphorylation | EPTPTVETRGTARGF CCCCCEEECCCCCCC | 30.02 | 30266825 | |
193 | Phosphorylation | HTSSFTSSLSLRYFT ECCCCCCCHHHHHHH | 20.94 | 17081983 | |
195 | Phosphorylation | SSFTSSLSLRYFTYG CCCCCCHHHHHHHHH | 16.85 | 17081983 | |
267 | Phosphorylation | AQTFQVLSTFMFVLM HHHHHHHHHHHHHHH | 22.27 | 17081983 | |
290 | Phosphorylation | LLPSSQDTPSKRGVR CCCCCCCCCCCCHHH | 23.09 | 20068230 | |
532 | Phosphorylation | NGELLPGSPNPEEPI CCCCCCCCCCCCCCC | 21.40 | 29514088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOT8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOT8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOT8_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MOT8_HUMAN !! |
Kegg Disease | |
---|---|
H00650 | Allan-Herndon-Dudley syndrome; Monocarboxylate transporter 8 deficiency |
OMIM Disease | |
300523 | Monocarboxylate transporter 8 deficiency (MCT8 deficiency) |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00149 | L-Leucine |
DB00150 | L-Tryptophan |
DB00135 | L-Tyrosine |
DB00451 | Levothyroxine |
DB01583 | Liotrix |
DB00119 | Pyruvic acid |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-193 AND SER-195, ANDMASS SPECTROMETRY. |