MOT6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MOT6_HUMAN
• UniProt AC: O15375
• Protein Name: Monocarboxylate transporter 6
• Gene Name: SLC16A5
• Organism: Homo sapiens (Human).
• Sequence Length: 505
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity)..
• Protein Sequence: MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
194	Phosphorylation	AIIRPVATSVAPETK HHHHHCCCCCCCCCC	24.78	26074081
195	Phosphorylation	IIRPVATSVAPETKE HHHHCCCCCCCCCCC	13.42	26074081
200	Phosphorylation	ATSVAPETKECPPPP CCCCCCCCCCCCCCC	30.96	26074081
396	Ubiquitination	DATNNFSYVFYMSSF HCCCCCCHHHHHHHH	7.16	22817900
397	Ubiquitination	ATNNFSYVFYMSSFF CCCCCCHHHHHHHHH	2.41	22817900
401	Ubiquitination	FSYVFYMSSFFLISA CCHHHHHHHHHHHHH	16.77	22817900
418	Ubiquitination	FMGGSFYALQKKEQG HHCHHHHHHHHHHHC	11.08	22817900
421	Ubiquitination	GSFYALQKKEQGKQA HHHHHHHHHHHCCHH	60.16	22817900
422	Ubiquitination	SFYALQKKEQGKQAV HHHHHHHHHHCCHHH	42.16	22817900
423	Ubiquitination	FYALQKKEQGKQAVA HHHHHHHHHCCHHHH	72.15	22817900
426	Ubiquitination	LQKKEQGKQAVAADA HHHHHHCCHHHHHHH	34.48	21906983
443	Ubiquitination	RDLFLEAKDGPGKQR HHHHHHCCCCCCCCC	54.57	21906983
448	Ubiquitination	EAKDGPGKQRSPEIM HCCCCCCCCCCCCHH	45.75	22817900
451	Phosphorylation	DGPGKQRSPEIMCQS CCCCCCCCCCHHCCC	25.13	25159151
461	Ubiquitination	IMCQSSRQPRPAGVN HHCCCCCCCCCCCCC	40.06	22817900
462	Ubiquitination	MCQSSRQPRPAGVNK HCCCCCCCCCCCCCH	43.01	22817900
466	Ubiquitination	SRQPRPAGVNKHLWG CCCCCCCCCCHHCCC	26.64	21906983
466	Ubiquitination	SRQPRPAGVNKHLWG CCCCCCCCCCHHCCC	26.64	22817900
483	Ubiquitination	ASSRTSHEWLLWPKA CCCCCCCCHHHCHHH	39.32	21906983
483	Ubiquitination	ASSRTSHEWLLWPKA CCCCCCCCHHHCHHH	39.32	22817900
488	Ubiquitination	SHEWLLWPKAVLQAK CCCHHHCHHHHHHHH	18.07	22817900
489	Ubiquitination	HEWLLWPKAVLQAKQ CCHHHCHHHHHHHHH	39.27	33845483

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MOT6_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MOT6_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MOT6_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of MOT6_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00119: Pyruvic acid