UniProt ID | MOT6_HUMAN | |
---|---|---|
UniProt AC | O15375 | |
Protein Name | Monocarboxylate transporter 6 | |
Gene Name | SLC16A5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 505 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).. | |
Protein Sequence | MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
194 | Phosphorylation | AIIRPVATSVAPETK HHHHHCCCCCCCCCC | 24.78 | 26074081 | |
195 | Phosphorylation | IIRPVATSVAPETKE HHHHCCCCCCCCCCC | 13.42 | 26074081 | |
200 | Phosphorylation | ATSVAPETKECPPPP CCCCCCCCCCCCCCC | 30.96 | 26074081 | |
396 | Ubiquitination | DATNNFSYVFYMSSF HCCCCCCHHHHHHHH | 7.16 | 22817900 | |
397 | Ubiquitination | ATNNFSYVFYMSSFF CCCCCCHHHHHHHHH | 2.41 | 22817900 | |
401 | Ubiquitination | FSYVFYMSSFFLISA CCHHHHHHHHHHHHH | 16.77 | 22817900 | |
418 | Ubiquitination | FMGGSFYALQKKEQG HHCHHHHHHHHHHHC | 11.08 | 22817900 | |
421 | Ubiquitination | GSFYALQKKEQGKQA HHHHHHHHHHHCCHH | 60.16 | 22817900 | |
422 | Ubiquitination | SFYALQKKEQGKQAV HHHHHHHHHHCCHHH | 42.16 | 22817900 | |
423 | Ubiquitination | FYALQKKEQGKQAVA HHHHHHHHHCCHHHH | 72.15 | 22817900 | |
426 | Ubiquitination | LQKKEQGKQAVAADA HHHHHHCCHHHHHHH | 34.48 | 21906983 | |
443 | Ubiquitination | RDLFLEAKDGPGKQR HHHHHHCCCCCCCCC | 54.57 | 21906983 | |
448 | Ubiquitination | EAKDGPGKQRSPEIM HCCCCCCCCCCCCHH | 45.75 | 22817900 | |
451 | Phosphorylation | DGPGKQRSPEIMCQS CCCCCCCCCCHHCCC | 25.13 | 25159151 | |
461 | Ubiquitination | IMCQSSRQPRPAGVN HHCCCCCCCCCCCCC | 40.06 | 22817900 | |
462 | Ubiquitination | MCQSSRQPRPAGVNK HCCCCCCCCCCCCCH | 43.01 | 22817900 | |
466 | Ubiquitination | SRQPRPAGVNKHLWG CCCCCCCCCCHHCCC | 26.64 | 21906983 | |
466 | Ubiquitination | SRQPRPAGVNKHLWG CCCCCCCCCCHHCCC | 26.64 | 22817900 | |
483 | Ubiquitination | ASSRTSHEWLLWPKA CCCCCCCCHHHCHHH | 39.32 | 21906983 | |
483 | Ubiquitination | ASSRTSHEWLLWPKA CCCCCCCCHHHCHHH | 39.32 | 22817900 | |
488 | Ubiquitination | SHEWLLWPKAVLQAK CCCHHHCHHHHHHHH | 18.07 | 22817900 | |
489 | Ubiquitination | HEWLLWPKAVLQAKQ CCHHHCHHHHHHHHH | 39.27 | 33845483 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOT6_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOT6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOT6_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of MOT6_HUMAN !! |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00119 | Pyruvic acid |
loading...