dbPTM

MORN2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MORN2_HUMAN
UniProt AC	Q502X0
Protein Name	MORN repeat-containing protein 2 {ECO:0000312\|HGNC:HGNC:30166}
Gene Name	MORN2 {ECO:0000312\|HGNC:HGNC:30166}
Organism	Homo sapiens (Human).
Sequence Length	79
Subcellular Localization	Cytoplasmic vesicle, secretory vesicle, acrosome . Nucleus . Associated with the acrosome during post-meiotic stages of spermatogenesis. Appears to migrate to the nucleus during the final step of spermiogenesis.
Protein Description	Might have a role in spermatogenesis..
Protein Sequence	MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRVEGEGEYTDIQGLEWSGNFHFTAAPDLKLKLHM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
38	Phosphorylation	TFPNGAKYTGNFNEN ECCCCCEEECCCCCC	21.24	17924679

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MORN2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MORN2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
38	Phosphorylation	48 (10)	E ⇒ K	rs3099950	Amyotrophic lateral sclerosis	19451621

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MORN2_HUMAN !!

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MORN2_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."; Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.; J. Proteome Res. 6:4150-4162(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-38, AND MASSSPECTROMETRY.	17924679 [Abstract]