dbPTM

MOG_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MOG_HUMAN
UniProt AC	Q16653
Protein Name	Myelin-oligodendrocyte glycoprotein
Gene Name	MOG
Organism	Homo sapiens (Human).
Sequence Length	247
Subcellular Localization	Isoform 1: Cell membrane Multi-pass membrane protein . Isoform 5: Cell membrane Multi-pass membrane protein . Isoform 2: Cell membrane Single-pass type I membrane protein . Isoform 3: Cell membrane Single-pass type I membrane protein . Isoform
Protein Description	Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.; (Microbial infection) Acts as a receptor for rubella virus..
Protein Sequence	MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MASLSRPSLP -----CCCCCCCCHH	26.11	27174698
5	Phosphorylation	---MASLSRPSLPSC ---CCCCCCCCHHHH	39.38	27174698
56	Phosphorylation	VELPCRISPGKNATG EEEECEECCCCCCCC	14.30	24719451
60	N-linked_Glycosylation	CRISPGKNATGMEVG CEECCCCCCCCCEEE	48.96	UniProtKB CARBOHYD
62	Phosphorylation	ISPGKNATGMEVGWY ECCCCCCCCCEEEEE	46.59	24719451
80	Phosphorylation	FSRVVHLYRNGKDQD CCEEEEEHHCCCCCC	6.27	18083107
196	Phosphorylation	EIENLHRTFDPHFLR HHHHHHHHCCHHHHC	22.95	24719451
196 (in isoform 2)	Phosphorylation	-	22.95	-
196 (in isoform 6)	Phosphorylation	-	22.95	24719451
205 (in isoform 8)	Phosphorylation	-	16.30	-
212	Phosphorylation	PCWKITLFVIVPVLG CCCEEEEHHHHHHHH	2.36	24719451
212 (in isoform 6)	Phosphorylation	-	2.36	24719451
228 (in isoform 7)	Phosphorylation	-	10.04	-
251 (in isoform 5)	Phosphorylation	-		-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MOG_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MOG_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MOG_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MOG_HUMAN !!

Drug and Disease Associations

Kegg Disease
H01293	Narcolepsy
OMIM Disease
614250	Narcolepsy 7 (NRCLP7)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MOG_HUMAN

Related Literatures of Post-Translational Modification